DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and ntsr2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_017949971.1 Gene:ntsr2 ID: Length:430 Species:Xenopus tropicalis

Alignment Length:479 Identity:136/480 (28%)
Similarity:212/480 (44%) Gaps:132/480 (28%)


  Fly    78 NLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHT-- 140
            |||..:...|.|  |.::....||...:.:..:||.|.|||:.|.:||::|..::.:.:..|.  
 Frog     9 NLSLPMAEPNST--SDLSHQLDVDTHFSSKVFITVFYILIFLVGTIGNVLTIRLVLKKHNRHKLQ 71

  Fly   141 -ATNFYLFNLAVSDLILLVSGIPQELYN-LW--YPDMYPFTDAMCIMGSVLSEMAANATVLTITA 201
             ..:::|.::|:||:::|:..||.|||| :|  ||  :.|.||:|.....|.::.:.||||.||:
 Frog    72 GTVHYHLVSMALSDILILLISIPIELYNFIWVHYP--WIFGDAVCRSYYFLRDICSYATVLNITS 134

  Fly   202 FTVERYIAICHPF-RQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQN---EGYS----- 257
            .:.|||:|||||. .:..|||: |..|.:..||.::.:.|:|.|....|.|:|   ||..     
 Frog   135 LSCERYLAICHPMTAKRIMSKM-RTKKILSVIWFSSVVFAMPMAFIMGVKYENTTPEGEEDPSSL 198

  Fly   258 -CT-MENDFYAHVF-AVSGFIFFGGPMTAI-CVLYVLIG-VKLKRSRLLQSL------PRRTFDA 311
             || :.:.....|| .|:.|:.|..|:..| |:..|.:. ::..|||...||      |:.::.|
 Frog   199 ICTNLVSTATLKVFIQVNVFVSFLLPLALISCLNCVTVNQLESLRSRYFLSLHSSSKAPQASYRA 263

  Fly   312 N------------RGLNAQGRV--------------------IRMLVAVAVAFFLCWAPFHAQRL 344
            :            :.|:..|..                    |.||.|:.:|:.:||.|:||:||
 Frog   264 HVSLKPVSSSPAVKKLSVAGATSKSSLTVSCEPNRIQPIQHSIYMLRAIVIAYVVCWLPYHARRL 328

  Fly   345 MAVYGLNLINIGISRD-------AFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKIT 402
            |..|        |..|       .|..||.:|..|   |:::|:.:||:|||::|..|||.|..|
 Frog   329 MFCY--------IPDDYWTGFLYTFYHYFYMLTNT---LFYVSSAVNPILYNMVSSSFRELFLET 382

  Fly   403 LTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQFRCRDANH 467
            |    |.:|....||                                               .|.
 Frog   383 L----GFSRRRKEQQ-----------------------------------------------LNS 396

  Fly   468 QLSLQDSIRTTTTTTTINSNSMAA 491
            .:|||.|:|:.|.|....:|...|
 Frog   397 SVSLQTSLRSDTCTLHTPTNHRQA 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 50/135 (37%)
7tm_1 124..388 CDD:278431 98/329 (30%)
ntsr2XP_017949971.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.