DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and mlnr

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_003200046.1 Gene:mlnr ZFINID:ZDB-GENE-130530-1015 Length:345 Species:Danio rerio

Alignment Length:329 Identity:111/330 (34%)
Similarity:170/330 (52%) Gaps:34/330 (10%)


  Fly   105 TLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLW 169
            ||....|:| ..:|:.||.||.:|.::|.|...|.|.||.||.::|:|||::.:| :|.:||.||
Zfish    15 TLIPVTTIC-IFLFIIGVTGNTMTILIIQRFKDMKTTTNLYLSSMAISDLVIFLS-LPFDLYRLW 77

  Fly   170 YPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFR-QHTMSKLSRAIKF-IFAI 232
            ....:.|.:.:|.:...::|...|||:|.||..::|||:|||.||: :..::|  |.:|: |.|:
Zfish    78 KYVPWIFGEFVCRLSHYINEGCTNATILHITVLSMERYLAICFPFKAKAAITK--RRVKYVILAL 140

  Fly   233 WLAAFLLALPQAMQFSVVYQNE------GYSC-----TMENDFYAHVFAVSGFIFFGGPMTAICV 286
            |..|.|.|.|......|.|:||      ...|     .:|:........||...|| .||..:..
Zfish   141 WGFALLSAAPMFFLMGVEYENETMPDPGSRQCKHTRYAIESGLLHTTIWVSTAYFF-CPMFCLLF 204

  Fly   287 LYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLN 351
            ||..||.||.:||  ..|......|.:.:|.|  .:::|..|...|.:||.|:|..|.:..:..:
Zfish   205 LYGSIGRKLWKSR--HELHGPNAAARQKVNRQ--TVKILAVVVSVFAICWLPYHIGRFLFTHVDD 265

  Fly   352 LINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQ 416
            ..:..:|:: ||       ..|.||::||..:||:|||:||:|:|.|.|    |.|.|.|.:...
Zfish   266 YHSARLSQN-FN-------VASMVLFYLSASVNPVLYNLMSNKYRSAVK----RLFLLPRGYQGT 318

  Fly   417 QSQH 420
            ..:|
Zfish   319 NRRH 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 50/130 (38%)
7tm_1 124..388 CDD:278431 91/277 (33%)
mlnrXP_003200046.1 7tm_4 24..>153 CDD:304433 51/132 (39%)
7tm_1 33..294 CDD:278431 91/277 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66668001
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.