DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and nmur2

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_002940961.1 Gene:nmur2 XenbaseID:XB-GENE-6046084 Length:397 Species:Xenopus tropicalis

Alignment Length:348 Identity:119/349 (34%)
Similarity:186/349 (53%) Gaps:47/349 (13%)


  Fly    72 LNITTENLSNLLGSTNGTNASTMAADSPVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNN 136
            ||.|.|.|:.|.|              |....|:|  .:|:.||.||:.||:||.:.|:||.:::
 Frog    25 LNSTEEYLAYLCG--------------PKRSRLSL--PMTLVYATIFLIGVIGNTLVCLVILKHH 73

  Fly   137 FMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAM--CIMGSVLSEMAANATVLTI 199
            .|.|.||:|||:||||||::|:.|:|.|:|.:|  ..|||....  |...:||.|....|::|::
 Frog    74 NMRTPTNYYLFSLAVSDLLVLLLGMPLEVYEMW--SNYPFLFGAWGCYFKTVLFETVCFASILSV 136

  Fly   200 TAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQ--------NEGY 256
            |..:||||:||.|||:....|..|||:|.:..:|:.:.|.::|......::.|        .:..
 Frog   137 TTVSVERYVAIIHPFQAKLKSTRSRALKILVTLWIFSILFSIPNTSTHGILLQYFPNGSLIPDSA 201

  Fly   257 SCTMENDFYAH--VFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQG 319
            :||:....:.:  :..|:..:|:..||..|.|||.|:|:||:..   .||.......|....::.
 Frog   202 TCTVVQPLWIYNCIIQVTSLLFYILPMGVISVLYCLMGIKLRGD---HSLEADKMSVNVQRPSRK 263

  Fly   320 RVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLN----LINIGISRDAFNDYFRILDYTSGVLYFLS 380
            .:.:||..:.:.|.:||||||..||...:.|:    |.|      |||    :....|||.::||
 Frog   264 SITKMLFVLVMVFGICWAPFHVDRLFFSFVLDWTEPLAN------AFN----LTHVVSGVFFYLS 318

  Fly   381 TCINPLLYNIMSHKFREAFKITL 403
            :.:|||:||::|.:||.||:..|
 Frog   319 SAVNPLIYNLLSRRFRSAFQNVL 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 56/130 (43%)
7tm_1 124..388 CDD:278431 94/280 (34%)
nmur2XP_002940961.1 7tm_4 53..>234 CDD:304433 64/183 (35%)
7tm_1 61..326 CDD:278431 94/280 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66660384
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T129258
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
87.740

Return to query results.
Submit another query.