DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R1 and ghsr

DIOPT Version :9

Sequence 1:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_002931618.1 Gene:ghsr / 100497774 XenbaseID:XB-GENE-484475 Length:359 Species:Xenopus tropicalis


Alignment Length:305 Identity:104/305 - (34%)
Similarity:159/305 - (52%) Gaps:29/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPD 172
            |.:||...|:|:.|:.||::|.:|:|:...|.|.||.||.::|.|||::.:. :|.:||.||...
 Frog    37 TGITVTCILLFIIGISGNVMTMLVVSKYKDMRTTTNLYLSSMAFSDLLIFLC-MPLDLYRLWQYR 100

  Fly   173 MYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAF 237
            .:.|..::|.:...:||....:|:|.|||.:||||.|||.|.:...:....|....|..:|..:|
 Frog   101 PWNFGSSLCKLFQFVSECCTYSTILNITALSVERYFAICFPLKAKVVITKGRVKLVISVLWAVSF 165

  Fly   238 LLALPQAMQFSVVYQNEGYSCTMENDFYAHVFAV-SGF---------IFFGGPMTAICVLYVLIG 292
            :.|.|..:...|.::| |.:....|:..|..:|: ||.         |||..|:..:.|||.|||
 Frog   166 VSAGPIFVLVGVEHEN-GTNPLDTNECKATEYAIKSGLLTIMVWTSSIFFFLPVFCLTVLYTLIG 229

  Fly   293 VKLKRSRLLQSLPRRTFDANRGL----NAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLI 353
            .||.|.:      |.|...:..:    |.|  .::||..|..||.|||.|||..|.:........
 Frog   230 RKLWRRK------RETIGPHTSIRDKHNKQ--TVKMLAVVVFAFILCWLPFHVARYLFSKSFEAG 286

  Fly   354 NIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREA 398
            ::.|:  ..:.|..::.:   ||::||..|||:||||||.|:|.|
 Frog   287 SLEIA--LISQYCNLVSF---VLFYLSAAINPILYNIMSKKYRVA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 45/127 (35%)
7tm_1 124..388 CDD:278431 89/277 (32%)
ghsrXP_002931618.1 7tm_4 48..334 CDD:304433 99/294 (34%)
7tm_1 53..316 CDD:278431 89/277 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.