DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and mlnr

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_002935793.1 Gene:mlnr XenbaseID:XB-GENE-940650 Length:364 Species:Xenopus tropicalis

Alignment Length:368 Identity:113/369 (31%)
Similarity:179/369 (49%) Gaps:67/369 (18%)


  Fly   104 LTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNL 168
            :|....:|:...::.|.||:||.||.::|.|...|.|.|||||.::|:||||:|:| :|.:||.|
 Frog    32 ITTLIPVTIVLLIVMVVGVIGNTITILIIRRYKEMRTTTNFYLSSMAMSDLIILLS-LPFDLYRL 95

  Fly   169 WYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIW 233
            |....:.|...:|.....:||....:|:|.|||.::|||:|||.|.:...:...:|....|..:|
 Frog    96 WKSMPWIFGGFLCRFLHFISEGCTYSTILHITALSIERYLAICFPLKSKVLITKTRVKCVIVFLW 160

  Fly   234 LAAFLLALPQAMQFSVVYQNEGYSCTMEND--------FYA-HVFAVSGFI---------FFGGP 280
            :.|.|.|.|   .:.||...:.|:.|.::|        ||| |    ||.:         :|..|
 Frog   161 VFALLSAGP---FYFVVGIAQMYNITNDSDTGWECRYTFYAVH----SGLLNVMMWVTTTYFFIP 218

  Fly   281 MTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGR------VIRMLVAVAVAFFLCWAPF 339
            |..:.:||..||.||.:|:          ::.||.|...|      .:|:|..|.:||.:||.||
 Frog   219 MFCLIILYGFIGKKLWKSQ----------NSIRGRNTAQRDKSHRQTMRILAVVVLAFIICWLPF 273

  Fly   340 HAQRLMAVYGLNLINI-GISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFRE-AFKIT 402
            |..|::      ..|. |.....|:.||.::...   |::||..|||:|||::|.|:|. |:|:.
 Frog   274 HIGRIV------FANTEGYEMMKFSQYFNVVAIQ---LFYLSASINPILYNLISKKYRSAAYKLL 329

  Fly   403 LTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVN 445
                         :.|...:..|:.:....|. :.:.::|..|
 Frog   330 -------------RPSTAKKKTYNTIKNDTGD-KTESSACVHN 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 50/128 (39%)
7tm_1 124..388 CDD:278431 96/289 (33%)
mlnrXP_002935793.1 7tm_4 43..>225 CDD:304433 65/190 (34%)
7tm_1 52..314 CDD:278431 96/289 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66675276
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.