DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and ghsrb

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_002666717.1 Gene:ghsrb ZFINID:ZDB-GENE-090327-1 Length:365 Species:Danio rerio

Alignment Length:342 Identity:113/343 (33%)
Similarity:175/343 (51%) Gaps:41/343 (12%)


  Fly    86 TNGTNAS------TMAADSPVDESLT-------------LRTALTVCYALIFVAGVLGNLITCIV 131
            ||.||.|      |:.|::.:|.:.|             :.|.:||..:.:|:.|:.|||:|.:|
Zfish     2 TNWTNVSICPLSITLCAENIMDSNATSEDEYPVHLFPVPILTGITVTCSFLFLVGIAGNLLTILV 66

  Fly   132 ISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATV 196
            :::...|.|.||.||.::|:|||::.:. :|.:||.:|....:.|.|.:|.:...:||....:|:
Zfish    67 VTKYKDMRTTTNLYLCSMALSDLLIFLC-MPLDLYRVWRYRPWNFGDELCKLFQFVSESCTYSTI 130

  Fly   197 LTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFSVVYQNEGYSCTME 261
            |.|||.:||||.|||.|.|...:....|....|..:|..|...|.|..:...|.::| |.:....
Zfish   131 LNITALSVERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHEN-GTNAWET 194

  Fly   262 NDFYAHVFAV-SGF---------IFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLN 316
            |:..|..:|: ||.         :||..|:..:.|||.|||.:|.|.:.....|..:.|.:   |
Zfish   195 NECKATEYAIRSGLLTMMVWVSSVFFFLPVLCLTVLYSLIGRRLWRRKENPVGPISSRDKS---N 256

  Fly   317 AQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLST 381
            .|  .::||..|.:||.|||.|||..|.:........:..||:  .::|..::.:   ||::||.
Zfish   257 KQ--TVKMLAVVVLAFVLCWLPFHVGRYLVSKSSEANSPVISQ--ISEYCNLVSF---VLFYLSA 314

  Fly   382 CINPLLYNIMSHKFREA 398
            .|||:||||||.|||.|
Zfish   315 AINPILYNIMSKKFRSA 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 45/128 (35%)
7tm_1 124..388 CDD:278431 90/274 (33%)
ghsrbXP_002666717.1 7tm_4 55..339 CDD:304433 100/290 (34%)
7tm_1 59..321 CDD:278431 90/274 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66663103
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.