DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R1 and LOC100331465

Sequence 1:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_017213239.1 Gene:LOC100331465 ID: Length:442 Species:Danio rerio

Alignment Length:427 Identity:111/428 (26%)
Similarity:176/428 (41%) Gaps:105/428 (25%)


  Fly    57 LLLKNDKFL-----THVAHLLNITTENLSNLLGSTNGT--NASTMAADSP--VDESLTLRTALTV 112
            |.|.||..:     .|.|.:||   .:.:..|...|||  :|..:....|  ..|..:||..|  
Zfish     3 LQLLNDTGIWACLQLHNASILN---RSSNGSLEVPNGTCEDALLLPKIEPARAKEMDSLRILL-- 62

  Fly   113 CYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDM---Y 174
             |.|||:..|.|||:..:|:..|..|.|.||.:|.:||:|||::.|..:|..|    .|::   :
Zfish    63 -YCLIFLLSVFGNLLIIVVLMVNKRMRTVTNSFLLSLAISDLMMAVVCMPFTL----IPNLMGDF 122

  Fly   175 PFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLL 239
            .|..|||.:.:.|..::...:..::.|..:|||.|||:|.:.......|.|.|.|.:.|:.:||:
Zfish   123 IFGAAMCKIVAYLMGISVCISTFSLVAIAIERYSAICNPLKSRAWQTRSHAYKVIASTWVVSFLI 187

  Fly   240 ALPQAMQFSVVYQNEGYSCTMENDFYAHV--------------FAVSGFIFFGGPMTAICVLYVL 290
            ..|..: ||.:.:     .|..|:...|:              ..:..|:.|..|...:.:.|.|
Zfish   188 MTPYPI-FSTLVE-----FTKNNNITGHMCRHDWKNSEVEKAWCILLLFVLFFIPGVVMIIAYGL 246

  Fly   291 IGVKLKR------------------------------------------SRLLQSL--------- 304
            |..:|.|                                          |..:.:|         
Zfish   247 ISRELYRGIQFELEQKKGQCGMKNGISATVLISSDDGDGCYIQVSKRPNSMEMSALTPTGSAKVD 311

  Fly   305 -PR-RTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFR 367
             || .|.:|.  |.|:.||||||:.:...||:||.|.::......:.|...:..:| .|...:..
Zfish   312 RPRSNTSEAK--LMAKKRVIRMLIVIVAMFFICWMPVYSVNTWKAFDLASAHRALS-GAPISFIH 373

  Fly   368 ILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLT 404
            :|.||       |.|:||::|..|:.:||:|...|.:
Zfish   374 LLSYT-------SACVNPIIYCFMNKRFRKALLATFS 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 44/131 (34%)
7tm_1 124..388 CDD:278431 82/334 (25%)
LOC100331465XP_017213239.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.