DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Ghsr

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_114464.1 Gene:Ghsr RGDID:621397 Length:364 Species:Rattus norvegicus

Alignment Length:325 Identity:128/326 (39%)
Similarity:166/326 (51%) Gaps:36/326 (11%)


  Fly    50 PEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISD-M 113
            |:|||    |:.|..|||.::.....:|:.|:.|||:|.:|:||...:.|.||.||.::|.|| :
  Rat    30 PDELL----PLFPAPLLAGVTATCVALFVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLL 90

  Fly   114 ILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTM 178
            |.||  ||.||..||....:.|.|.:|.|...:||:...||||||||.:||||.|||.|.|...:
  Rat    91 IFLC--MPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVV 153

  Fly   179 SKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTSCTMKNDFFAHVFAV-SGFL-------- 234
            ....|....|..||..|...|.|..:...|..:. ||.....|:..|..||| ||.|        
  Rat   154 VTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHEN-GTDPRDTNECRATEFAVRSGLLTVMVWVSS 217

  Fly   235 -FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPF 298
             ||..|:..:.|||.|||.||.|.|...|:.....|.|     ..:.::||..|..||.:||.||
  Rat   218 VFFFLPVFCLTVLYSLIGRKLWRRRGDAAVGASLRDQN-----HKQTVKMLAVVVFAFILCWLPF 277

  Fly   299 HAQR-LMAVYGSTSGIE----SQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREA-FKV 357
            |..| |.:.......:|    ||:.|.|       |.||::||..|||:||||||.|:|.| ||:
  Rat   278 HVGRYLFSKSFEPGSLEIAQISQYCNLV-------SFVLFYLSAAINPILYNIMSKKYRVAVFKL 335

  Fly   358  357
              Rat   336  335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 107/277 (39%)
GhsrNP_114464.1 7tm_4 53..>171 CDD:304433 54/120 (45%)
7tm_1 59..321 CDD:278431 107/277 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66699699
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.