DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and gpr39

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_956711.1 Gene:gpr39 ZFINID:ZDB-GENE-040426-1395 Length:440 Species:Danio rerio

Alignment Length:467 Identity:124/468 (26%)
Similarity:206/468 (44%) Gaps:77/468 (16%)


  Fly    46 QGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLIT---CIVISRNNFMHTATNFYLFN 107
            |.|||.           ..|...|:|.|.||...|||||..|   ..|:.||.::..:...::.:
Zfish    11 QQLEPS-----------YGLKVFLTVLYCLILSLGVLGNSATIHVAQVLQRNGYLQRSVAEHMVS 64

  Fly   108 LAISDMILLCSGMPQDLYN-LWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICH 171
            ||.||:::|..|:|.:||: :|.|......|:.|.:.:.|.|..:.||:|.:...::|||:||||
Zfish    65 LACSDLLVLLIGLPVELYSAIWFPFLSRSGDAACRIYNFLFELCSYATILNVATLSLERYLAICH 129

  Fly   172 PFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQF----------SVVMQGMGTSCTMKNDFFAH 226
            |||...: :..|..:.:.|.|:.:.|:|||..:..          ...:|.: |.||..:..:. 
Zfish   130 PFRYRAL-RGGRTRRLLLAAWLCSALVALPLLVATGTEGYVPAGRQTPVQNL-TFCTSLSQHWV- 191

  Fly   227 VFAVSGFLFFGGPMTAICVLYVLI--GVKLKRSRLLQAL-----PRRC-------YDVNRGISAQ 277
            ::..|.|..|        |||:|:  ||......::..|     |...       :...||.:::
Zfish   192 MYRTSIFTAF--------VLYLLVLAGVAFMCRAMILVLRAPMGPAEAGASGDHKHQSARGKASR 248

  Fly   278 TRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGI-ESQWFNDVFSI---LDYTSGVLYFLSTC 338
            .:.|..||.:..|.|:||.|...:|||     |:.: :|.|.....:.   |...:...::||:.
Zfish   249 KQTILFLVLIVCALFVCWMPNQIRRLM-----TAAVPKSSWTGSYLTSYIKLHPVADSFFYLSSV 308

  Fly   339 INPLLYNIMSHKFREAFKVTLARHFGLGGKNQGRGLPHTYSALRRNQT------GSL-RLHTTDS 396
            :||:|||:.|.:||.||..||.....|...|: |.|.::.::...|.|      .|| |:....|
Zfish   309 LNPMLYNLSSRQFRSAFLQTLLCRLSLQHANR-RTLENSGASKSSNNTLRPLLQRSLNRIRMATS 372

  Fly   397 VRTTMTSMATTTTGLNGSANGSGNGTTTGQSVRLNRVSLDSVQMQGQNRSRQDLFDNPRRMLQTQ 461
            .|:|..|.|.....||.:....|.|          :::||........:...:|..:.:...:.|
Zfish   373 SRSTPPSSAERRDSLNTTDRPQGEG----------KLTLDPQNTTNWPQGEGELTSDSQEKERNQ 427

  Fly   462 ISQLSSVGDAHS 473
            ::...::.|..|
Zfish   428 LTHCPTLPDEQS 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 78/293 (27%)
gpr39NP_956711.1 7tm_1 37..314 CDD:278431 78/293 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.