DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Gpr39

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_081953.2 Gene:Gpr39 MGIID:1918361 Length:456 Species:Mus musculus

Alignment Length:414 Identity:108/415 (26%)
Similarity:187/415 (45%) Gaps:63/415 (15%)


  Fly    68 TLSVGYALIFIAGVLGNLIT---CIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN-LW 128
            ||.:.|.:||:.|:|||.:|   ..|:.:..::......::.:||.||:::...|||.:.|: :|
Mouse    32 TLILVYLIIFVVGILGNSVTIRVTQVLQKKGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIW 96

  Fly   129 HPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFA-IW 192
            :|...|.....|.|.:.|.||.:.||:|.:...:.||||||||||:...:|. .|.||.:.. :|
Mouse    97 NPLTTPSYALSCKLHTFLFETCSYATLLHVLTLSFERYIAICHPFKYKAVSG-PRQVKLLIGFVW 160

  Fly   193 IAALLLALP----QAIQFSVV----MQGM-------------GTS----CTMKND----FFAHVF 228
            :.:.|:|||    ..|::.:|    .:|:             |.|    ||..::    |.:.:|
Mouse   161 VTSALVALPLLFAMGIEYPLVNVPTHKGLNCNLSRTRHHDEPGNSNMSICTNLSNRWEVFQSSIF 225

  Fly   229 -AVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPR---RCYDVNRGISAQTRVIRMLVAVAV 289
             |.:.:|.....:..:|...:.:.:|.|:..|....|:   |..:.....:|:.:.|..|..:.|
Mouse   226 GAFAVYLVVLASVAFMCWNMMKVLMKSKQGTLAGTGPQLQLRKSESEESRTARRQTIIFLRLIVV 290

  Fly   290 AFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREA 354
            ...:||.|...:|:||...........:|.....:|.: |...::||:.:||||||:.|.:||:.
Mouse   291 TLAVCWMPNQIRRIMAAAKPKHDWTRTYFRAYMILLPF-SDTFFYLSSVVNPLLYNVSSQQFRKV 354

  Fly   355 FKVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVRTTMTSMATTTTGLNGSANGSG 419
            |...|.....|...||.:         |:.........:|.|.|:.:..:|:.      .:|.| 
Mouse   355 FWQVLCCRLTLQHANQEK---------RQRARFISTKDSTSSARSPLIFLASR------RSNSS- 403

  Fly   420 NGTTTGQSVRLNRVSLDSVQMQGQ 443
                   |.|.|:|.|.:.|.:.:
Mouse   404 -------SRRTNKVFLSTFQTEAK 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 78/299 (26%)
Gpr39NP_081953.2 7tm_1 47..344 CDD:278431 78/299 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.