DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Ntsr2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_073186.1 Gene:Ntsr2 RGDID:70962 Length:416 Species:Rattus norvegicus

Alignment Length:375 Identity:105/376 (28%)
Similarity:163/376 (43%) Gaps:80/376 (21%)


  Fly    55 PTVTPMTPLSLLATLSVG------------YALIFIAGVLGNLITC-IVISRNNFMHTATNFYLF 106
            |..:|...|||.|.|.|.            |:|||..|..||.::. :|:...........:::.
  Rat     9 PRPSPSAGLSLEARLGVDTRLWAKVLFTALYSLIFAFGTAGNALSVHVVLKARAGRPGRLRYHVL 73

  Fly   107 NLAISDMILLCSGMPQDLYN-LWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERYIA 168
            :||:|.::||...||.:||| :|  .:||  |.|..|.....:.|..|.||||::.:.:.||.:|
  Rat    74 SLALSALLLLLVSMPMELYNFVW--SHYPWVFGDLGCRGYYFVRELCAYATVLSVASLSAERCLA 136

  Fly   169 ICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAI---QFSVVMQGMGTS------CTMKND-- 222
            :|.|.|...:....|..:.:..:|:|:|.||||.|:   |...|....|..      ||:...  
  Rat   137 VCQPLRARRLLTPRRTRRLLSLVWVASLGLALPMAVIMGQKHEVESADGEPEPASRVCTVLVSRA 201

  Fly   223 ------------FFAHVFAVSGFLFFGGPMTAICVLYV-----------------------LIGV 252
                        .||...|::.|| .|..:..:..||.                       |:|.
  Rat   202 TLQVFIQVNVLVSFALPLALTAFL-NGITVNHLMALYSQVPSASAQVSSIPSRLELLSEEGLLGF 265

  Fly   253 KLKRSRL---LQALPRRCYDVN--RGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSG 312
            ...|..|   :||...|..|.:  |.:....:|:|.:|||   :.|||.|:||:|||..|....|
  Rat   266 ITWRKTLSLGVQASLVRHKDASQIRSLQHSAQVLRAIVAV---YVICWLPYHARRLMYCYIPDDG 327

  Fly   313 IESQWFNDVFSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAFKVTL 359
                |.|:::....|   .:..|:::|:.:.|:|||.:|..||:.|..:|
  Rat   328 ----WTNELYDFYHYFYMVTNTLFYVSSAVTPILYNAVSSSFRKLFLESL 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 85/319 (27%)
Ntsr2NP_073186.1 7tm_1 87..358 CDD:278431 77/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.