DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Nmur2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_071611.3 Gene:Nmur2 RGDID:621155 Length:395 Species:Rattus norvegicus

Alignment Length:342 Identity:121/343 (35%)
Similarity:193/343 (56%) Gaps:39/343 (11%)


  Fly    30 LTQVLNISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRN 94
            |.:.||.:.:.|..|......:..||             :||.|||||:.||:|||:.|:||.|:
  Rat    14 LMKYLNSTEEYLAHLCGPKRSDLSLP-------------VSVAYALIFLVGVMGNLLVCMVIVRH 65

  Fly    95 NFMHTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYP--FSDSICILESVLSETAANATVLT 157
            ..:.|.||:|||:||:||:::|..|||.::|.:||  |||  |....|..::.|.||...|::|:
  Rat    66 QTLKTPTNYYLFSLAVSDLLVLLLGMPLEIYEMWH--NYPFLFGPVGCYFKTALFETVCFASILS 128

  Fly   158 ITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALP----QAIQFSVVMQGM----G 214
            :|..:||||:||.||||....|...||::.:..:|..:::.:||    ..|:|.....|.    .
  Rat   129 VTTVSVERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIKFQHFPNGSSVPGS 193

  Fly   215 TSCTMKNDFFAH--VFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQ 277
            .:||:....:.:  :...:.|||:..|||.|.|||.|:|::|||...|:| .:...:::|  .::
  Rat   194 ATCTVTKPMWVYNLIIQATSFLFYILPMTLISVLYYLMGLRLKRDESLEA-NKVAVNIHR--PSR 255

  Fly   278 TRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFND---VFSILDYTSGVLYFLSTCI 339
            ..|.:||..:.:.|.|||.|||..||.     .|.:| :|...   ||:::...|||.::||:.:
  Rat   256 KSVTKMLFVLVLVFAICWTPFHVDRLF-----FSFVE-EWTESLAAVFNLIHVVSGVFFYLSSAV 314

  Fly   340 NPLLYNIMSHKFREAFK 356
            ||::||::|.:||.||:
  Rat   315 NPIIYNLLSRRFRAAFR 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 98/276 (36%)
Nmur2NP_071611.3 7tm_4 48..333 CDD:304433 108/296 (36%)
7tm_1 54..319 CDD:278431 98/276 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66698130
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T131237
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.