DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and ntsr1

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_021329279.1 Gene:ntsr1 ZFINID:ZDB-GENE-090313-372 Length:400 Species:Danio rerio

Alignment Length:423 Identity:130/424 (31%)
Similarity:198/424 (47%) Gaps:91/424 (21%)


  Fly    30 LTQVLNISA-------DNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLIT 87
            |.|.|..||       ||.|..|.    ||.|...|.:....|:..:   |.::|:.|.|||.||
Zfish    17 LAQKLLSSANRSQPFLDNETESLS----EEDLDVNTDIYSKVLVTVI---YVVLFLIGCLGNSIT 74

  Fly    88 CIVI----SRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN-LW--HPDNYPFSDSICILESV 145
            ...:    |..|...| .:::|.:|||||:::|...||.:||| :|  ||  :.|.:::|.....
Zfish    75 LYTLLTKKSLQNLQST-VHYHLASLAISDLLILVLCMPIELYNFIWVHHP--WAFGEAVCKGYYF 136

  Fly   146 LSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVM 210
            |.:..:.||...|.:.:|||::||||||:..::...||..|.|.|:|||:..||.|  :.|::..
Zfish   137 LRDGCSYATAFNIASLSVERFMAICHPFKAKSIMSRSRTKKLISAMWIASFFLATP--MLFTMGQ 199

  Fly   211 QGMG---------TSCTMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKR---------- 256
            |.|.         :|.|.|.     |..::.||.|..||..|..|..:|..:|.|          
Zfish   200 QLMNDEYICTTIVSSITAKT-----VLQLNAFLSFVVPMALISALNGVIASQLLRMFRESAQDNR 259

  Fly   257 --------SRLLQAL-PRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSG 312
                    :.|..|: |.|...:..|       :.:|.||.:||.:||.|:||:|||..|     
Zfish   260 VCIIGGNATMLSVAVEPNRAQSMRHG-------VMVLRAVVIAFVVCWLPYHARRLMYCY----- 312

  Fly   313 IESQWFNDVFSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAFKVTL------ARHFGLGGK 368
             .::|...::....|   .:.||:::|:.|||:|||::|..:|:.|..||      .||     |
Zfish   313 -VTEWTTALYDFYHYFYMVTNVLFYVSSAINPILYNLVSANYRQIFFSTLRYLILPCRH-----K 371

  Fly   369 NQGRGLPHTYSALRRNQTGSLRLHTTDSVRTTM 401
            .|.|.|.....::..|||.|     |:.::.|:
Zfish   372 KQKRVLTRHSISICSNQTFS-----TNVIKETI 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 93/299 (31%)
ntsr1XP_021329279.1 7tmA_NTSR1 54..357 CDD:320477 102/329 (31%)
TM helix 1 54..81 CDD:320477 9/30 (30%)
TM helix 2 91..117 CDD:320477 12/26 (46%)
TM helix 3 131..161 CDD:320477 10/30 (33%)
TM helix 4 173..195 CDD:320477 11/24 (46%)
TM helix 5 217..246 CDD:320477 10/34 (29%)
TM helix 6 280..310 CDD:320477 14/37 (38%)
TM helix 7 325..350 CDD:320477 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.