DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and nmur3

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_009304366.1 Gene:nmur3 ZFINID:ZDB-GENE-130530-567 Length:392 Species:Danio rerio

Alignment Length:346 Identity:123/347 (35%)
Similarity:189/347 (54%) Gaps:33/347 (10%)


  Fly    35 NISADNLTS------LLQGLEPEELLPTVTP-MTPLSLLATLSVGYALIFIAGVLGNLITCIVIS 92
            |.|..|.|.      .||.:: |.|...:.| .:|.....|.:  |.|||:.||||||:||.||:
Zfish    22 NSSTFNFTGNDSAHCYLQTID-EVLFKLLGPRRSPFFFPVTCT--YILIFMTGVLGNLLTCAVIT 83

  Fly    93 RNNFMHTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLT 157
            ::..|.|.||.|||:|||||:::|..|||.::|.||....:||.:|||..:..|.||...|:||.
Zfish    84 KDRKMQTPTNLYLFSLAISDLLVLLFGMPLEIYELWQNYPFPFGESICCFKIFLFETVCFASVLN 148

  Fly   158 ITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALP----QAIQFSVVMQGMGTSCT 218
            :|..:||||||:.||.:.........|.:.|..:|..:||.|:|    ..:|:..:.:.:..|.|
Zfish   149 VTVLSVERYIAVIHPLKTRYAITNKHARRVIAGVWAMSLLCAVPNTSLHGLQYQYLPERVQESAT 213

  Fly   219 ---MKNDFFAH-VFAVSGFLFFGGPMTAICVLYVLIGV------KLKRSRLLQALPRRCYDVNRG 273
               :|..:..: |..::..||:..||..|.|||::||:      |.|:.:|........:.::..
Zfish   214 CNLLKPKWMYNLVIQITTVLFYFVPMMMISVLYLMIGLTLGRGQKQKKDKLGSNHSNDSWKIHLD 278

  Fly   274 ISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYT---SGVLYFL 335
            ...:.:|.:|...|.:.|.|||||||..||:     .|.|.| |.:.:.:|.:|.   ||||::|
Zfish   279 SRRRRQVTKMHFVVVLVFAICWAPFHIDRLL-----WSFITS-WTDHMHNIFEYVHIISGVLFYL 337

  Fly   336 STCINPLLYNIMSHKFREAFK 356
            |:.:||::||::|.:|||.|:
Zfish   338 SSAVNPIIYNLLSSRFRERFQ 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 98/278 (35%)
nmur3XP_009304366.1 7tm_4 64..364 CDD:304433 112/302 (37%)
7tm_1 74..346 CDD:278431 98/278 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66691497
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.