DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and NTSR1

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_002522.2 Gene:NTSR1 HGNCID:8039 Length:418 Species:Homo sapiens

Alignment Length:381 Identity:115/382 (30%)
Similarity:178/382 (47%) Gaps:72/382 (19%)


  Fly    37 SADNLTSLLQGLEPEELLP-------------TVTPMTPLSL------LATLSVGYALIFIAGVL 82
            :||.......|||...|.|             ...|.:.|.:      ...::..|..:|:.|.:
Human    15 AADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTV 79

  Fly    83 GNLITCIVISRN---NFMHTATNFYLFNLAISDMILLCSGMPQDLYN-LW--HPDNYPFSDSICI 141
            ||.:|...::|.   ..:.:..:::|.:||:||::.|...||.:||| :|  ||  :.|.|:.|.
Human    80 GNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHP--WAFGDAGCR 142

  Fly   142 LESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQF 206
            ....|.:....||.|.:.:.:||||:||||||:..|:...||..|||.|||:|:.|||:|  :.|
Human   143 GYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVP--MLF 205

  Fly   207 SVVMQ----------GMGTSCTMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKL------- 254
            ::..|          |:..:.|:.......|..|:.|:.|..||..|.||..:|..||       
Human   206 TMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQA 270

  Fly   255 -----------KRSRLLQAL-PRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVY 307
                       :.|....|: |.|...:..|       :|:|.||.:||.:||.|:|.:|||..|
Human   271 AEQGQVCTVGGEHSTFSMAIEPGRVQALRHG-------VRVLRAVVIAFVVCWLPYHVRRLMFCY 328

  Fly   308 GSTSGIESQWFNDVFSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAFKVTLA 360
            .|    :.||...::....|   .:..|:::|:.|||:|||::|..||..|..|||
Human   329 IS----DEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLA 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 94/299 (31%)
NTSR1NP_002522.2 7tm_1 80..364 CDD:278431 94/299 (31%)
7tm_4 <159..381 CDD:304433 78/236 (33%)
Neurotensin binding. {ECO:0000250} 321..344 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.