DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and PK1-R

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001014620.1 Gene:PK1-R FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster

Alignment Length:468 Identity:192/469 (41%)
Similarity:255/469 (54%) Gaps:105/469 (22%)


  Fly    36 ISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTA 100
            :||.|::        .:|.|   |..||:::..::|.|:||||.||:||:.|||||.:|..||||
  Fly     1 MSAGNMS--------HDLGP---PRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTA 54

  Fly   101 TNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVER 165
            ||:|||:|||||.:||.||:||::..:|....|.|.:.|||...:|:||:|||||||||||||||
  Fly    55 TNYYLFSLAISDFLLLLSGVPQEVSYIWSKYPYVFGEYICIGRGLLAETSANATVLTITAFTVER 119

  Fly   166 YIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTSCTMKNDFFAHVFAV 230
            ||||||||....|||||||::.|..:||.|::.|:|||.||.:........|.:......|.|.:
  Fly   120 YIAICHPFLGQAMSKLSRAIRIIVLVWIMAIVTAIPQAAQFGIEHYSGVEQCGIVRVIVKHSFQL 184

  Fly   231 SGFLFFGGPMTAICVLYVLIGVKLKRSRLLQ---ALPRR--------------------CYDVNR 272
            |.|:||..||:.|.|||:||||.|.||.|::   ::.||                    ....|.
  Fly   185 STFIFFLAPMSIILVLYLLIGVHLYRSTLVEGPASVARRQQLKSVPSDTILYRYGGSGTAMSFNG 249

  Fly   273 GIS------------AQ-------------TRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSG 312
            |.|            ||             .||:||||||.|.||:||||||||||:|:|....|
  Fly   250 GGSGAGTAGLMGGSGAQLSSVRGRLNHYGTRRVLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARG 314

  Fly   313 IESQWFND-VFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKVTLARHFGLGGKNQGRGLPH 376
            .:.:..:: |::::.|.|||||:||||||||||||||||||||||..|.      ||...:|   
  Fly   315 AKLRDQHEFVYTVMTYVSGVLYYLSTCINPLLYNIMSHKFREAFKAVLF------GKKVSKG--- 370

  Fly   377 TYSALRRNQTGSLRLHTTDSVRTTMTSMATTTTGLNGSANGSGNGTTTGQSVRLNRVSLDSVQMQ 441
              |...||...|.||      |..:|:.:.|                       .|.|::|.:  
  Fly   371 --SLNSRNNIESRRL------RRALTNSSQT-----------------------QRFSIESAE-- 402

  Fly   442 GQNRSRQDLFDNP 454
               :.:..:..||
  Fly   403 ---QPKPSIMQNP 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 145/310 (47%)
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 164/337 (49%)
TM helix 1 21..48 CDD:320262 15/27 (56%)
TM helix 2 55..81 CDD:320262 16/26 (62%)
TM helix 3 94..124 CDD:320262 24/30 (80%)
TM helix 4 136..158 CDD:320262 11/22 (50%)
TM helix 5 178..207 CDD:320262 16/29 (55%)
TM helix 6 277..307 CDD:320262 21/30 (70%)
TM helix 7 326..351 CDD:320262 19/25 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66616375
eggNOG 1 0.900 E33208_3BGH7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I2874
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24243
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
77.020

Return to query results.
Submit another query.