DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and PK2-R1

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_731790.1 Gene:PK2-R1 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster

Alignment Length:647 Identity:346/648 (53%)
Similarity:409/648 (63%) Gaps:124/648 (19%)


  Fly    17 DLQLFHNEKFLLNLTQVLNISADNLTSLLQGLEPEELLPTVTPMTP----LSLLATLSVGYALIF 77
            ::.|..|:|||.::..:|||:.:||::|| |........|:...:|    |:|...|:|.|||||
  Fly    55 EMLLLKNDKFLTHVAHLLNITTENLSNLL-GSTNGTNASTMAADSPVDESLTLRTALTVCYALIF 118

  Fly    78 IAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICIL 142
            :|||||||||||||||||||||||||||||||:||:|||.||:||:|||||:||.|||:|::||:
  Fly   119 VAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIM 183

  Fly   143 ESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFS 207
            .|||||.|||||||||||||||||||||||||||||||||||:|||||||:||.|||||||:|||
  Fly   184 GSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAIKFIFAIWLAAFLLALPQAMQFS 248

  Fly   208 VVMQGMGTSCTMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNR 272
            ||.|..|.||||:|||:|||||||||:|||||||||||||||||||||||||||:||||.:|.||
  Fly   249 VVYQNEGYSCTMENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANR 313

  Fly   273 GISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYG---STSGIESQWFNDVFSILDYTSGVLYF 334
            |::||.||||||||||||||:|||||||||||||||   ...||....|||.|.|||||||||||
  Fly   314 GLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYF 378

  Fly   335 LSTCINPLLYNIMSHKFREAFKVTLARHFGLGGKN---QGRGLPHTYSALRRNQTGSLRLHTT-- 394
            ||||||||||||||||||||||:||.|.|||...:   |.:...|.||||.| |.||:||...  
  Fly   379 LSTCINPLLYNIMSHKFREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLR-QNGSMRLQPASC 442

  Fly   395 ------------------------------DSVRTTMTSMATTTTGLNGSANGSGNGTTTGQSVR 429
                                          ||:|||     ||||.:|.::..:|||...|....
  Fly   443 SVNNNALEPYGSYRVVQFRCRDANHQLSLQDSIRTT-----TTTTTINSNSMAAGNGVGGGAGGG 502

  Fly   430 LNRVSLDSVQMQGQNRSRQDLFDN------PRRMLQTQISQLSSVGDAHSLLEED---------- 478
            ..          |:...:|:|:..      |.||||.|:|||||:|||:||||.:          
  Fly   503 GG----------GRRLRKQELYGPGPGTAVPHRMLQAQVSQLSSLGDANSLLEAEVVDRHYASGR 557

  Fly   479 -------------LQFP---GEPLQ-RQPTMCSIDELTDDLAISRSRLKLTR-ITRPPGGVTGGV 525
                         |..|   |:|.: .||.               :|||||| |:|     ...|
  Fly   558 AKRALLATKSGALLVTPPQSGDPSEVSQPA---------------TRLKLTRVISR-----RDEV 602

  Fly   526 AGGSTTGAAGSGGVSGDESSGKVRKAKVKVLKSSSPFKGLRTKFNWRARRKGSHKPHEKGAT 587
            |..||....||..:...|:           .:|:|.......||.||.||:.:..|..:|.|
  Fly   603 ANTSTPPFCGSHSLPDPET-----------CQSASVAGRSSRKFPWRKRRQKTEDPSSEGLT 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 220/264 (83%)
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 111/128 (87%)
7tm_1 124..388 CDD:278431 220/264 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66616310
eggNOG 1 0.900 E33208_3BGH7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I2874
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24243
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
77.020

Return to query results.
Submit another query.