DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and CCHa1-R

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_611241.2 Gene:CCHa1-R FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster

Alignment Length:423 Identity:110/424 (26%)
Similarity:185/424 (44%) Gaps:46/424 (11%)


  Fly    52 ELLPTVTPMTPLSL---LATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDM 113
            ||:.|.||..|...   ...:.:.:||||:.|||||....:|......|....|.|:.:||::|:
  Fly    64 ELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADL 128

  Fly   114 ILLCSGMP--QDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQ- 175
            :::.:.:|  ..:|.:   :.:|:...:|.|...:.:.:...:|.|:||.:.:||.||..|.|: 
  Fly   129 LVIITTVPLASTVYTV---EYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKF 190

  Fly   176 HTMSKLSRAVKFIFA----IWIAALLLALPQAIQFSVVMQGMGTS----CTMKNDFFAHVFAVSG 232
            |......||.:...|    ||:.|:|..||..|..::...|:...    |....:.:...:|.|.
  Fly   191 HAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSM 255

  Fly   233 FL-----FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFF 292
            .|     ::..|:..|.|.||||.:.|..|   .::|.......|.:.|:.:|...::|..|.|.
  Fly   256 VLLHFLVYYAIPLVVIAVFYVLIALHLMYS---ASVPGEIQGAVRQVRARRKVAVTVLAFVVIFG 317

  Fly   293 ICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAF-K 356
            ||:.|:|...|...:..|:..:...|..|..|:.|   .:.|.::|.||:....:|..||:.| :
  Fly   318 ICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAY---CMSFANSCANPVALYFVSGAFRKHFNR 379

  Fly   357 VTLARHFGLGGKNQGRGLPHTYSALR---RNQTGSLRLHTTDS-----VRTTMTSMATTTTGLNG 413
            ....|  |..|:.:.||...|:...|   ...|.|.|..:..|     :|:......|.||..||
  Fly   380 YLFCR--GASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCYQSTIRSCRLQETTITTLPNG 442

  Fly   414 SANGSGNGTTTGQSVRLNRVSLDSVQMQGQNRS 446
                   |...|.::....::|..:|..|.|.:
  Fly   443 -------GNQNGANISAVELALPVLQAPGHNEA 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 70/277 (25%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 30/103 (29%)
7tm_1 98..364 CDD:278431 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2468688
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.