DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and CCHa2-R

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001356958.1 Gene:CCHa2-R FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster

Alignment Length:468 Identity:128/469 (27%)
Similarity:213/469 (45%) Gaps:73/469 (16%)


  Fly     9 NSSGVLATDLQLFHNEKFLLNLTQVLNISADNLTSLLQGLEPEELLPTV-TPMTPLSLLATLSVG 72
            |.||:|||. |....|:..|.|....|.|||.      |:.|  .:|.: .|.|.:     ::|.
  Fly    25 NDSGLLATG-QGLEQEQEGLALDMGHNASADG------GIVP--YVPVLDRPETYI-----VTVL 75

  Fly    73 YALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDM--ILLCSGMPQDLYNLWHPDNYPF 135
            |.||||.|||||....|:..|:..|....|.|:.:||::|:  ||:|..:...:|.   .:::||
  Fly    76 YTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALADLLVILVCVPVATIVYT---QESWPF 137

  Fly   136 SDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFA---IWIAALL 197
            ..::|.:.....:.:...:|.|:||.:.|||.||.:|.|     ||......:|.   |||.|:|
  Fly   138 ERNMCRISEFFKDISIGVSVFTLTALSGERYCAIVNPLR-----KLQTKPLTVFTAVMIWILAIL 197

  Fly   198 LALPQAIQFSVVMQGMGTS--------CTMKNDFFAHVFAVSG--FLFFGGPMTAICVLYVLIGV 252
            |.:|..:...:....:.|:        |:...|.....|.|:|  .:::..|::.|..||:::..
  Fly   198 LGMPSVLFSDIKSYPVFTATGNMTIEVCSPFRDPEYAKFMVAGKALVYYLLPLSIIGALYIMMAK 262

  Fly   253 KLKRSRLLQALPRRCYDVNRGISAQTR--VIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIES 315
            :|..|  .:.:|.....:.....|:.|  |.||:||..|.||||:.|:|...|...:..|:   .
  Fly   263 RLHMS--ARNMPGEQQSMQSRTQARARLHVARMVVAFVVVFFICFFPYHVFELWYHFYPTA---E 322

  Fly   316 QWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK-----VTLARHFGLGGKNQGRGLP 375
            :.|::.:::|........||::|:||:....:|..||:.|.     :.:.|...|...:...|:.
  Fly   323 EDFDEFWNVLRIVGFCTSFLNSCVNPVALYCVSGVFRQHFNRYLCCICVKRQPHLRQHSTATGMM 387

  Fly   376 HTYS--ALRRN-----QTGSLR--LHTTDSVRTTMTSMATTTTGLNGSANGSGNGTTTGQSVRLN 431
            ...|  ::||:     ..|:||  ||            ..:..|:.|:..|.|.|..:|:....:
  Fly   388 DNTSVMSMRRSTYVGGTAGNLRASLH------------RNSNHGVGGAGGGVGGGVGSGRVGSFH 440

  Fly   432 RVSLDSVQMQGQN 444
            |  .||:.:|..|
  Fly   441 R--QDSMPLQHGN 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 74/278 (27%)
CCHa2-RNP_001356958.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2468726
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.