DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK2-R2 and Gpr39

DIOPT Version :9

Sequence 1:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001107864.1 Gene:Gpr39 / 288995 RGDID:1306745 Length:456 Species:Rattus norvegicus


Alignment Length:456 Identity:113/456 - (24%)
Similarity:204/456 - (44%) Gaps:75/456 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TLSVGYALIFIAGVLGNLIT---CIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN-LW 128
            ||::.|.::|:.|:|||.:|   ..|:.:..::......::.:||.||:::...|||.:.|: :|
  Rat    32 TLTLVYLIVFVVGILGNSVTIRVTQVLQKKGYLQKEVTDHMISLACSDILVFLIGMPMEFYSIIW 96

  Fly   129 HPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWI 193
            :|...|.....|.|.:.|.||.:.||:|.:...:.|||||||||||...:|...:....|..:|:
  Rat    97 NPLTTPSYALSCKLHTFLFETCSYATLLHVLTLSFERYIAICHPFRYKDVSGPCQVKLLIGFVWV 161

  Fly   194 AALLLALP----QAIQFSV--VMQGMGTSCTMKND-----------------------FFAHVF- 228
            .:.|:|||    ..|::.:  |....|.:|.:...                       |.:.:| 
  Rat   162 TSALVALPLLFAMGIEYPLANVPTHKGLNCNLSRTRHHDHPGDSNMSICTNLSSRWEVFQSSIFG 226

  Fly   229 AVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPR---RCYDVNRGISAQTRVIRMLVAVAVA 290
            |.:.:|.....:..:|...:.:.:|.||..|....|:   |..:.....:|:.:.|..|..:.|.
  Rat   227 AFAVYLVVLVSVAFMCWNMMKVLMKSKRGTLAGTGPQLQLRKSESEESRTARRQTIIFLRLIVVT 291

  Fly   291 FFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAF 355
            ..:||.|...:|:||...........:|.....:|.: |...::||:.:||||||:.|.:||:.|
  Rat   292 LAVCWMPNQIRRIMAAAKPKHDWTKSYFKAYMILLPF-SDTFFYLSSVVNPLLYNVSSQQFRKVF 355

  Fly   356 KVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVRTTMTSMATTTTGLNGSANGSGN 420
            ...|.....|...||.:.....:|:.:         :::.|.|:.:..:|:.      .:|.|  
  Rat   356 WQVLCCRLTLQHANQEKQQRAYFSSTK---------NSSRSARSPLIFLASR------RSNSS-- 403

  Fly   421 GTTTGQSVRLNRVSLDSVQ-----MQGQNRSRQDLFDNPRRMLQTQISQLSSVGDA--HSLLEED 478
                  |.|.|:|.|.:.|     ::|:::....  ::|    ||. |:....|.|  :||.|::
  Rat   404 ------SRRTNKVFLSTFQAEAKPLEGEHQPLSP--ESP----QTG-SETKPAGSATENSLQEQE 455

  Fly   479 L 479
            :
  Rat   456 V 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 74/297 (25%)
Gpr39NP_001107864.1 7tm_1 47..344 CDD:278431 74/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.