DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and GPR39

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001499.1 Gene:GPR39 HGNCID:4496 Length:453 Species:Homo sapiens

Alignment Length:437 Identity:109/438 (25%)
Similarity:175/438 (40%) Gaps:103/438 (24%)


  Fly    68 TLSVGYALIFIAGVLGNLIT---CIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN-LW 128
            ||.:.|.:||:.|:|||..|   ..|:.:..::......::.:||.||:::...|||.:.|: :|
Human    32 TLILVYLIIFVMGLLGNSATIRVTQVLQKKGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIW 96

  Fly   129 HP---DNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFA 190
            :|   .:|..|   |.|.:.|.|..:.||:|.:...:.|||||||||||...:|...:....|..
Human    97 NPLTTSSYTLS---CKLHTFLFEACSYATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGF 158

  Fly   191 IWIAALLLALPQAIQFSVVMQGMGTS--------------------------------CTMKNDF 223
            :|:.:.|:|||       ::..|||.                                ||..:..
Human   159 VWVTSALVALP-------LLFAMGTEYPLVNVPSHRGLTCNRSSTRHHEQPETSNMSICTNLSSR 216

  Fly   224 FAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPR----------RCYDVNRGISAQT 278
            :. ||..|.|..|      :..|.||:.|......::|.|.:          |...:.:..|.::
Human   217 WT-VFQSSIFGAF------VVYLVVLLSVAFMCWNMMQVLMKSQKGSLAGGTRPPQLRKSESEES 274

  Fly   279 RVIR-----MLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTC 338
            |..|     .|..:.|...:||.|...:|:||...........:|.....:|.: |...::||:.
Human   275 RTARRQTIIFLRLIVVTLAVCWMPNQIRRIMAAAKPKHDWTRSYFRAYMILLPF-SETFFYLSSV 338

  Fly   339 INPLLYNIMSHKFREAFKVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLH---TTDSVRTT 400
            ||||||.:.|.:||..|...|.....|...|..:               .||:|   ||||.|..
Human   339 INPLLYTVSSQQFRRVFVQVLCCRLSLQHANHEK---------------RLRVHAHSTTDSARFV 388

  Fly   401 MTSMATTTTGLNGSANGSGNGTTTGQSVRLNRVSLDSVQMQGQNRSR 447
            ...:      |..|...|       .:.|..::.|.:.|.:.:.:|:
Human   389 QRPL------LFASRRQS-------SARRTEKIFLSTFQSEAEPQSK 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 79/315 (25%)
GPR39NP_001499.1 7tmA_GPR39 31..355 CDD:320263 90/341 (26%)
TM helix 1 31..58 CDD:320263 11/26 (42%)
TM helix 2 68..94 CDD:320263 8/26 (31%)
TM helix 3 108..138 CDD:320263 13/30 (43%)
TM helix 4 150..172 CDD:320263 6/29 (21%)
TM helix 5 217..246 CDD:320263 9/36 (25%)
TM helix 6 276..306 CDD:320263 8/30 (27%)
TM helix 7 323..348 CDD:320263 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.