DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and MLNR

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001498.1 Gene:MLNR HGNCID:4495 Length:412 Species:Homo sapiens

Alignment Length:408 Identity:121/409 (30%)
Similarity:183/409 (45%) Gaps:88/409 (22%)


  Fly    62 PLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN 126
            ||..|..::.....:|:.||.||::|.::|.|...|.|.||.||.::|:||:::|. |:|.|||.
Human    34 PLGALVPVTAVCLCLFVVGVSGNVVTVMLIGRYRDMRTTTNLYLGSMAVSDLLILL-GLPFDLYR 97

  Fly   127 LWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAI 191
            ||....:.|...:|.|...:.|....||:|.:||.:||||:|||.|.|...:....|....|..:
Human    98 LWRSRPWVFGPLLCRLSLYVGEGCTYATLLHMTALSVERYLAICRPLRARVLVTRRRVRALIAVL 162

  Fly   192 WIAALLLALPQAIQFSV-------VMQGMGTSCTMKNDFFAH----------------------- 226
            |..|||.|.|......|       |:.|:..:..:.:...|.                       
Human   163 WAVALLSAGPFLFLVGVEQDPGISVVPGLNGTARIASSPLASSPPLWLSRAPPPSPPSGPETAEA 227

  Fly   227 ---------------------VFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDV 270
                                 ::..:.:.|.  |...:.:||.|||.:|..||  :.|       
Human   228 AALFSRECRPSPAQLGALRVMLWVTTAYFFL--PFLCLSILYGLIGRELWSSR--RPL------- 281

  Fly   271 NRGISAQTR------VIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTS 329
             ||.:|..|      .:|:|:.|.:||.|||.|||..|:  :|.:|......:|:..|:|:... 
Human   282 -RGPAASGRERGHRQTVRVLLVVVLAFIICWLPFHVGRI--IYINTEDSRMMYFSQYFNIVALQ- 342

  Fly   330 GVLYFLSTCINPLLYNIMSHKFR-EAFKVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHT 393
              |::||..|||:|||::|.|:| .|||:.|||      |::.||...:     |:..|.:...|
Human   343 --LFYLSASINPILYNLISKKYRAAAFKLLLAR------KSRPRGFHRS-----RDTAGEVAGDT 394

  Fly   394 -TDSVRTTMTSMATTTTG 410
             .|:|..|.||....|.|
Human   395 GGDTVGYTETSANVKTMG 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 91/318 (29%)
MLNRNP_001498.1 7tm_1 55..355 CDD:278431 91/318 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66692779
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.