DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and GHSR

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_940799.1 Gene:GHSR HGNCID:4267 Length:366 Species:Homo sapiens

Alignment Length:369 Identity:134/370 (36%)
Similarity:175/370 (47%) Gaps:54/370 (15%)


  Fly    51 EELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISD-MI 114
            :|||    .:.|..|||.::.....:|:.|:.|||:|.:|:||...:.|.||.||.::|.|| :|
Human    32 DELL----QLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLI 92

  Fly   115 LLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMS 179
            .||  ||.||..||....:.|.|.:|.|...:||:...||||||||.:||||.|||.|.|...:.
Human    93 FLC--MPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVV 155

  Fly   180 KLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTSCTMKNDFFAHVFAV-SGFL--------- 234
            ...|....||.||..|...|.|..:...|..:. ||.....|:.....||| ||.|         
Human   156 TKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHEN-GTDPWDTNECRPTEFAVRSGLLTVMVWVSSI 219

  Fly   235 FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQ----TRVIRMLVAVAVAFFICW 295
            ||..|:..:.|||.|||.||.|        ||..|...|.|.:    .:.::||..|..||.:||
Human   220 FFFLPVFCLTVLYSLIGRKLWR--------RRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCW 276

  Fly   296 APFHAQR-LMAVYGSTSGIE----SQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAF 355
            .|||..| |.:.......:|    ||:.|.|       |.||::||..|||:||||||.|:|   
Human   277 LPFHVGRYLFSKSFEPGSLEIAQISQYCNLV-------SFVLFYLSAAINPILYNIMSKKYR--- 331

  Fly   356 KVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVRT 399
             |.:.|..|..        |.:...|...:..|.|..|..|:.|
Human   332 -VAVFRLLGFE--------PFSQRKLSTLKDESSRAWTESSINT 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 108/281 (38%)
GHSRNP_940799.1 7tmA_GHSR 44..334 CDD:320259 119/312 (38%)
TM helix 1 44..71 CDD:320259 10/27 (37%)
TM helix 2 78..103 CDD:320259 14/27 (52%)
TM helix 3 116..146 CDD:320259 18/30 (60%)
TM helix 4 158..180 CDD:320259 8/22 (36%)
TM helix 5 209..238 CDD:320259 10/29 (34%)
TM helix 6 256..286 CDD:320259 12/30 (40%)
TM helix 7 302..327 CDD:320259 16/32 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66725532
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.