DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Olfr979

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_667319.1 Gene:Olfr979 MGIID:3030813 Length:311 Species:Mus musculus

Alignment Length:323 Identity:65/324 (20%)
Similarity:126/324 (39%) Gaps:73/324 (23%)


  Fly    62 PLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN 126
            |.:|...|.|.:.:|:|..||||.:..:||..::.:||...::|.||:..||......:|:.|..
Mouse    18 PPALDTMLFVAFLVIYILTVLGNFLILMVIRVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMT 82

  Fly   127 LWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFA- 190
            |..|.....|...|:.:........:......|..:.:||:||.:|.|..:|  :|..|..:.| 
Mouse    83 LVSPRGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYDRYLAISYPLRYSSM--MSGRVCALLAA 145

  Fly   191 -IWIAALLLALPQAIQFSVVMQ--------------------GMGTSCTMKND--FFAHVFAVSG 232
             .||..   :|..|:|.::..:                    .:..:.|..|:  .|.::..|:.
Mouse   146 GTWITG---SLHSAVQTTLTFRLPYCGPNQIQHYFCDAPPILKLACADTSANEMVIFVNIGVVAS 207

  Fly   233 FLFFGGPMTAICVLYVLIGVKLK--RSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFI-C 294
            ..|....::.:.::..::.::..  |.|..|.....|                  .|.:.||: |
Mouse   208 GCFLLISLSYVSIVCSILRIRTSEGRHRAFQTCASHC------------------IVVLCFFVPC 254

  Fly   295 WAPFHAQRLMAVY---GSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREA 354
                     :.:|   ||...::.     |.::. ||     .|:..:||::|.:.:.:.::|
Mouse   255 ---------VFIYLRPGSRDAVDG-----VVAVF-YT-----VLTPLLNPVVYTLRNKEVKKA 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 55/291 (19%)
Olfr979NP_667319.1 7tm_4 29..301 CDD:304433 61/313 (19%)
7tm_1 39..287 CDD:278431 55/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7505
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.