DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Cckbr

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_037297.1 Gene:Cckbr RGDID:2290 Length:452 Species:Rattus norvegicus

Alignment Length:425 Identity:107/426 (25%)
Similarity:164/426 (38%) Gaps:130/426 (31%)


  Fly    27 LLNLTQVLNISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVI 91
            |||.:...|:|.|          |..:..|.|....:::..||   ||:||:..|.||::..:|:
  Rat    28 LLNSSSAGNLSCD----------PPRIRGTGTRELEMAIRITL---YAVIFLMSVGGNVLIIVVL 79

  Fly    92 SRNNFMHTATNFYLFNLAISDMILLCSGMPQDLY-NLWHPDNYPFSDSICILESVLSETAANATV 155
            ..:..:.|.||.:|.:||:||::|..:.||..|. ||.  ..:.|...||...|.|...:.:.:.
  Rat    80 GLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLM--GTFIFGTVICKAISYLMGVSVSVST 142

  Fly   156 LTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSV------VMQGM- 213
            |.:.|..:|||.|||.|.:.......|.|.:.|.|.|:.:.||.:|..:...|      |:|.| 
  Rat   143 LNLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYPVYTMVQPVGPRVLQCMH 207

  Fly   214 -GTSCTMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIG-------------------------- 251
             ..|..::..:...:.    .|.|..|...|.|.|.||.                          
  Rat   208 RWPSARVQQTWSVLLL----LLLFFIPGVVIAVAYGLISRELYLGLHFDGENDSETQSRARNQGG 268

  Fly   252 -------------------------------VKLKRSRLLQAL-----------PRRCYDVNRG- 273
                                           |:|.||||....           ||    .|:. 
  Rat   269 LPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCVQLPRSRLEMTTLTTPTPGPVPGPR----PNQAK 329

  Fly   274 ISAQTRVIRMLVAVAVAFFICWAPFH------------AQRLMAVYGSTSGIESQWFNDVFSILD 326
            :.|:.||:|||:.:.:.||:||.|.:            |||.:      ||....:.:       
  Rat   330 LLAKKRVVRMLLVIVLLFFLCWLPVYSVNTWRAFDGPGAQRAL------SGAPISFIH------- 381

  Fly   327 YTSGVLYFLSTCINPLLYNIMSHKFREAFKVTLAR 361
                :|.::|.|:|||:|..|..:||:|...|.||
  Rat   382 ----LLSYVSACVNPLVYCFMHRRFRQACLDTCAR 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 83/351 (24%)
CckbrNP_037297.1 7tm_4 60..>243 CDD:304433 58/192 (30%)
7tm_1 71..395 CDD:278431 83/351 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.