| Sequence 1: | NP_731788.1 | Gene: | PK2-R2 / 41638 | FlyBaseID: | FBgn0038139 | Length: | 599 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_694719.2 | Gene: | Nmur2 / 216749 | MGIID: | 2441765 | Length: | 395 | Species: | Mus musculus | 
| Alignment Length: | 333 | Identity: | 120/333 - (36%) | 
|---|---|---|---|
| Similarity: | 191/333 - (57%) | Gaps: | 28/333 - (8%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    39 DNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNF 103 
  Fly   104 YLFNLAISDMILLCSGMPQDLYNLWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERY 166 
  Fly   167 IAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALP----QAIQFSVVMQGM----GTSCTMKNDF 223 
  Fly   224 FAHVFAV--SGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVA 286 
  Fly   287 VAVAFFICWAPFHAQRLMAVYGSTSGIESQWFND---VFSILDYTSGVLYFLSTCINPLLYNIMS 348 
  Fly   349 HKFREAFK 356 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| PK2-R2 | NP_731788.1 | 7tm_1 | 83..344 | CDD:278431 | 97/275 (35%) | 
| Nmur2 | NP_694719.2 | 7tm_4 | 48..333 | CDD:304433 | 107/295 (36%) | 
| 7tm_1 | 54..319 | CDD:278431 | 97/275 (35%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167835274 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E33208_3BGH7 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D380940at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | mtm8878 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24243 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5416 | 
| SonicParanoid | 1 | 1.000 | - | - | X673 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| 10 | 9.840 | |||||