DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Nmur2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_694719.2 Gene:Nmur2 MGIID:2441765 Length:395 Species:Mus musculus

Alignment Length:333 Identity:120/334 (36%)
Similarity:191/334 (57%) Gaps:28/334 (8%)


  Fly    39 DNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNF 103
            |:|...|.  ..||.|..:.......|...:||.|||||:.||:|||:.|:||:|:..:.|.||:
Mouse    12 DSLMKYLN--STEEYLAYLCGPKRSDLSLPVSVVYALIFVVGVIGNLLVCLVIARHQTLKTPTNY 74

  Fly   104 YLFNLAISDMILLCSGMPQDLYNLWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERY 166
            |||:||:||:::|..|||.::|.|||  |||  |....|..::.|.||...|::|::|..::|||
Mouse    75 YLFSLAVSDLLVLLLGMPLEVYELWH--NYPFLFGPVGCYFKTALFETVCFASILSVTTVSIERY 137

  Fly   167 IAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALP----QAIQFSVVMQGM----GTSCTMKNDF 223
            :||.||||....|...||::.:..:|..:::.:||    ..|:|.....|.    ..:||:....
Mouse   138 VAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIKFQQFPNGSSVPGSATCTVTKPI 202

  Fly   224 FAHVFAV--SGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVA 286
            :.:.|.:  :.|||:..|||.|.|||.|:|::|||...|:| .:...:::|  .::..|.:||..
Mouse   203 WVYNFIIQATSFLFYILPMTLISVLYYLMGLRLKRDESLEA-DKVTVNIHR--PSRKSVTKMLFV 264

  Fly   287 VAVAFFICWAPFHAQRLMAVYGSTSGIESQWFND---VFSILDYTSGVLYFLSTCINPLLYNIMS 348
            :.:.|.|||.|||..||...:      ..:|...   ||:::...|||.::||:.:||::||::|
Mouse   265 LVLVFAICWTPFHVDRLFFSF------VDEWTESLAAVFNLIHVVSGVFFYLSSAVNPIIYNLLS 323

  Fly   349 HKFREAFK 356
            .:||.||:
Mouse   324 RRFRAAFR 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 97/276 (35%)
Nmur2NP_694719.2 7tm_4 48..333 CDD:304433 107/296 (36%)
7tm_1 54..319 CDD:278431 97/276 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66718071
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T130989
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.