DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and npr-14

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_493283.3 Gene:npr-14 WormBaseID:WBGene00012275 Length:342 Species:Caenorhabditis elegans

Alignment Length:351 Identity:84/352 (24%)
Similarity:143/352 (41%) Gaps:55/352 (16%)


  Fly    27 LLNLTQVLNISA--DNLTSLLQGLE-----------PEELLPTVTPMTPLSLLATLSVGYALIFI 78
            :|:...|.:.|:  |..||.:.||:           .|.|.|.......:.:||::       .:
 Worm     1 MLDYNNVTSGSSEEDYDTSEIIGLQVNTHEEYEDIIAEALWPNAVEQWFVYILASM-------MV 58

  Fly    79 AGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN-----LWHPDNYPFSDS 138
            .||:||.:..:|::.|..|..|.|..|.||||:|:::|...:|..:.|     .|      ||..
 Worm    59 IGVIGNTLVVVVVATNKSMRNALNLVLMNLAIADLLILLFCLPLTVVNDVTKTFW------FSAV 117

  Fly   139 ICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQA 203
            .|...:.::.|:...:::::...|.||:.||.:|.:    |...|....|..||..|:.|:.|:.
 Worm   118 FCKSVNFVNNTSVYVSIMSLVFITCERWRAITYPLK----SPFVRTRSVIGGIWFIAMFLSSPEP 178

  Fly   204 IQFSVV---------MQGMGTSC--TMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRS 257
            :...:.         ....||.|  :...:|..:...:.....|..|:..|.:|.      |...
 Worm   179 VTLHLAGAPFVRPNFTTKWGTRCKESWSEEFQKNYQLLQTIFSFVLPLLVISILC------LHMV 237

  Fly   258 RLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVF 322
            |.|..........||.||.:.:.:|||.||...|.:...|.|...:...|...|...|   .:..
 Worm   238 RTLHFSANYLTVANRQISIRKKAVRMLCAVVFLFSMSNLPVHLYNIALNYDLLSTDVS---TNTI 299

  Fly   323 SILDYTSGVLYFLSTCINPLLYNIMS 348
            ::......|..:.|:|:||:||:.:|
 Worm   300 AVRKLLPRVFSYSSSCLNPILYSFLS 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 67/277 (24%)
npr-14NP_493283.3 7tm_1 63..321 CDD:278431 67/277 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66616591
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.