DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and nmur-3

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001024524.1 Gene:nmur-3 WormBaseID:WBGene00017176 Length:445 Species:Caenorhabditis elegans

Alignment Length:436 Identity:124/437 (28%)
Similarity:182/437 (42%) Gaps:108/437 (25%)


  Fly     3 VKMLPTNSSGVLATDLQL----FHNE-KFLLNLT--------QVLNISADNLTSLLQGLEPEELL 54
            ::.|..|:|....|..:|    ||.: :||.::|        :..|.|::.|.     |:...|.
 Worm    16 IRRLILNNSNTPITTKELIKHCFHPDVQFLAHMTLKSLDHPGEQFNNSSNQLL-----LDRAFLN 75

  Fly    55 PTVTPMTPLSLLATLSVGYALIFI----AGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMIL 115
            |.:|                |||:    .|::|||:|.|||.:.|.:|:.||::|.|||.||..|
 Worm    76 PILT----------------LIFVFVGLVGLIGNLLTVIVIFKTNSLHSHTNYFLANLATSDFCL 124

  Fly   116 LCSGMPQDLYNLWHPDNYPFS-DSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMS 179
            :..|:..||.|:|: |..|.. ...|.|.|........|::|||...|.||:.|||:||...|:.
 Worm   125 IVVGVSFDLVNIWN-DEEPLDIFGYCSLTSTFISLFTFASILTIVLLTAERFTAICYPFSHRTIF 188

  Fly   180 KLSRAVKFIFAIWIAALLLALPQAIQFSVVMQ------------GMGTSCTMKNDFFAHVFAVSG 232
            ...|..:||..||..|||.::.....|..|.|            |.....|..:.||.:.|..:.
 Worm   189 DEKRVKRFILLIWFVALLPSIFIGSMFKRVSQDFCGFNRQMTYIGRCDLVTSPDSFFRYPFESAI 253

  Fly   233 FLFFGGPMTAICVLY---------VLIGVKLKRSRLL---------------------------- 260
            .:.|..|:..|...|         :.|.|.|..:..:                            
 Worm   254 TITFVLPLFFIIYCYFRILGTRHFLCITVNLSYTSNIFPVTLNEMSNSTHVHTPVGTARSDSGAF 318

  Fly   261 -----------QALPRRCYDVN----RGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGST 310
                       |:.|...:..|    |...||..||:|||.|...||:|:.|:|||||:..|.|.
 Worm   319 PFPHTSNNSNTQSFPLTVHTKNVQPPRSQQAQKMVIKMLVTVTAVFFVCYLPYHAQRLIVKYNSK 383

  Fly   311 SGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK 356
            ....|    |...:|...:|:|.::|..:||:.||:||.:||..||
 Worm   384 DCSNS----DFCKLLYPIAGILQYISASLNPIFYNLMSVRFRNGFK 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 95/326 (29%)
nmur-3NP_001024524.1 7tm_4 82..>224 CDD:304433 54/143 (38%)
7tm_1 92..413 CDD:278431 95/326 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.