DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and npr-35

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001023088.1 Gene:npr-35 WormBaseID:WBGene00016842 Length:381 Species:Caenorhabditis elegans

Alignment Length:445 Identity:107/446 (24%)
Similarity:183/446 (41%) Gaps:88/446 (20%)


  Fly    28 LNLTQVLNISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVIS 92
            :|.:.|..:.||     ::.|||..||.....:|.|     .:|.|..:|..|||||....:.:.
 Worm     1 MNTSFVEPLYAD-----VEQLEPVPLLRHSYQLTVL-----YTVAYGAVFFTGVLGNTFVVLAVW 55

  Fly    93 RNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN------LWHPDNYPFSDSICILESVLSETAA 151
            .:..::..|::.:.:||::|:.:|...:|..|.|      ||       ....|.|.:..:.:.:
 Worm    56 AHKNLNITTDYLILSLALADLFILWICLPTTLINSIFTEWLW-------GQFFCRLSTWANASTS 113

  Fly   152 NATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGT- 215
            .|:|.|:.|.|.:||:||||..:.:|..........|||:|:.|.:..:|....:.:::...|: 
 Worm   114 FASVYTLVAVTADRYLAICHTLKYNTSWDREYTKYVIFAVWLVAAIFGIPNWYNYDLIVWQEGSY 178

  Fly   216 ---SCTMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQ 277
               .||.:.|...:...|:..|.|..|...|..||..|.:.:...|.|....|...|     ..:
 Worm   179 GYRLCTSQTDQKLYFLFVNLLLAFIVPFGLISGLYTRIFITVSTHRSLAVDARARED-----RVK 238

  Fly   278 TRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWF------NDVFSILDYTSGVLY--- 333
            .||..|::.|.:.|..||.|.:.            |.:.:|      :|:|.|.......::   
 Worm   239 LRVATMMLTVIIVFACCWLPLYC------------IFTYFFFFADQRSDLFQITSMLIRPIFQWM 291

  Fly   334 -FLSTCINPLLYNIMSHKFREAFKVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHT---T 394
             .||:.:||::|...|||:|.|||..|              |....:...|.::..||.|:   .
 Worm   292 SLLSSSLNPIIYIAYSHKYRRAFKSIL--------------LMPCKTRYERVRSTILRRHSRGFK 342

  Fly   395 DSVRTTMTSMATTTTGLNGSANGSGNGTTTGQSVRLNRVSLDSVQMQGQNRSRQD 449
            .:...:|::..|..|.|.|:::              ..:.||..|::   ||..|
 Worm   343 STATISMSNFGTEPTNLGGASS--------------LLIELDGKQVE---RSTSD 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 65/281 (23%)
npr-35NP_001023088.1 7tm_4 41..>238 CDD:304433 51/209 (24%)
7tm_1 46..303 CDD:278431 65/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66616479
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.