DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Ntsr2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_032773.2 Gene:Ntsr2 MGIID:108018 Length:416 Species:Mus musculus

Alignment Length:379 Identity:100/380 (26%)
Similarity:163/380 (43%) Gaps:86/380 (23%)


  Fly    55 PTVTPMTPLSLLATLSVG------------YALIFIAGVLGNLITC-IVISRNNFMHTATNFYLF 106
            |..:|...|||.|.|.|.            |:|||..|..||.::. :|:...........:::.
Mouse     9 PRPSPSAGLSLEARLGVDTRLWAKVLFTALYSLIFALGTAGNALSVHVVLKARAGRPGRLRYHVL 73

  Fly   107 NLAISDMILLCSGMPQDLYN-LWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERYIA 168
            :||:|.::||...:|.:||| :|  .:||  |.|..|.....:.|..|.||||::.:.:.||.:|
Mouse    74 SLALSALLLLLISVPMELYNFVW--SHYPWVFGDLGCRGYYFVRELCAYATVLSVASLSAERCLA 136

  Fly   169 ICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVM-------------QGMGTSCTM- 219
            :|.|.|...:....|..:.:..:|:|:|.||||.|    |:|             :.....||: 
Mouse   137 VCQPLRARRLLTPRRTRRLLSLVWVASLGLALPMA----VIMGQKHEMERADGEPEPASRVCTVL 197

  Fly   220 -----------KNDFFAHVFAVSGFLFFGG-PMTAICVLYV-----------------------L 249
                       .|...:.|..::...|..| .:..:..||.                       |
Mouse   198 VSRATLQVFIQVNVLVSFVLPLALTAFLNGITVNHLVALYSQVPSASAQVNSIPSRLELLSEEGL 262

  Fly   250 IGVKLKRSRL---LQALPRRCYDVN--RGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGS 309
            :|....|..|   :||...|..|.:  |.:....:|:|.:|||   :.|||.|:||:|||..|..
Mouse   263 LGFITWRKTLSLGVQASLVRHKDASQIRSLQHSAQVLRAIVAV---YVICWLPYHARRLMYCYIP 324

  Fly   310 TSGIESQWFNDVFSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAFKVTLA 360
            ..|    |.::::....|   .:..|:::|:.:.|:|||.:|..||:.|..:|:
Mouse   325 DDG----WTDELYDFYHYFYMVTNTLFYVSSAVTPVLYNAVSSSFRKLFLESLS 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 80/322 (25%)
Ntsr2NP_032773.2 7tm_1 85..358 CDD:278431 72/286 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.