DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and nmur-2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_493666.2 Gene:nmur-2 WormBaseID:WBGene00019616 Length:403 Species:Caenorhabditis elegans

Alignment Length:387 Identity:125/388 (32%)
Similarity:187/388 (48%) Gaps:68/388 (18%)


  Fly    53 LLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLC 117
            ::|||             :.|..||:.|:.||:.|||||:.|..||..||:|||:||:||:|.|.
 Worm    31 VIPTV-------------IIYGTIFLLGLFGNICTCIVIAANKSMHNPTNYYLFSLAVSDIIALI 82

  Fly   118 SGMPQDLY-NLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKL 181
            .|:|.:.| :|.:...|.||:.||...:.|.|..:.|:::.|..|:.||::|||||.|....|.|
 Worm    83 LGLPMEFYQSLDYSYPYRFSEGICKARAFLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTL 147

  Fly   182 SRAVKFIFAIWIAALLLALPQA--IQFSVV-------MQGMGTSCTMKNDFFAH----------- 226
            .||...|...|..:.:.|||.|  :|.:.:       .|......:....|..|           
 Worm   148 WRANVLIILAWTISFVCALPIAFIVQINKLPLPEDAKYQPWTNKVSTDGIFVLHTEFCAMNQSRP 212

  Fly   227 -------VFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRL----LQALPRRCYDVNRGISAQTRV 280
                   :||.:  :||..|..||.::|..|.|:|:.|.:    .:.:.:|....||      .|
 Worm   213 DQQKMIIIFAFT--VFFVIPAIAIVIMYAHIAVQLESSEIDLKGDKMVKKRRNKSNR------TV 269

  Fly   281 IRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILD----YTSGVLYFLSTCINP 341
            ::||::|.:.|||||.|||.|||::||  |:..|:...:.....|.    |.||..|:.::..||
 Worm   270 LKMLLSVVITFFICWLPFHIQRLLSVY--TTWSETTTISPPVQFLSMIVFYISGFCYYSNSAANP 332

  Fly   342 LLYNIMSHKFREAF-KVTLARHFG----LGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVR 398
            :||||:|.|:|.|| :..|..|..    .|.:..|:....:.|.....:|    |.|..|||
 Worm   333 ILYNILSQKYRSAFCRTILGDHIANFVFKGHQRPGQSKRCSSSTEAEQRT----LMTRGSVR 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 99/297 (33%)
nmur-2NP_493666.2 7tm_4 42..286 CDD:304433 83/252 (33%)
7tm_1 48..335 CDD:278431 99/297 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
66.000

Return to query results.
Submit another query.