DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Nmur1

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001306156.1 Gene:Nmur1 MGIID:1341898 Length:428 Species:Mus musculus

Alignment Length:386 Identity:139/387 (36%)
Similarity:205/387 (53%) Gaps:58/387 (15%)


  Fly    34 LNISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMH 98
            ||::.:.|.  |:.|.|:::...|          .:.|.|.|||:.|.|||.:||.||.||..|.
Mouse    40 LNLTDEALR--LKYLGPQQMKQFV----------PICVTYLLIFVVGTLGNGLTCTVILRNKTMR 92

  Fly    99 TATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPF--SDSICILESVLSETAANATVLTITAF 161
            |.||||||:||:|||::|..|:|.:||.:  ..||||  ..|.|....:|.||...|:||.:||.
Mouse    93 TPTNFYLFSLAVSDMLVLLVGLPLELYEM--QQNYPFQLGASACYFRILLLETVCLASVLNVTAL 155

  Fly   162 TVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQA-----IQFSVVMQGM---GTSCT 218
            :||||:|:..|.:..::...:...:.:.|||:.|.|.:||..     .|.:|..:|.   ...|:
Mouse   156 SVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICS 220

  Fly   219 MKN--DFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLL--------------QALPRRC 267
            :..  ||:..|...:..|||..||..|.|||:|||::|:|.|:|              :...||.
Mouse   221 LVGPMDFYKLVVLTTALLFFCLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRI 285

  Fly   268 YDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLM--AVYG-STSGIESQWFNDVFSILDYTS 329
            ...:||   :.:|.:||.|:.|.|.||||||||.|:|  .||| ||.|:..     .:..:...|
Mouse   286 QLQDRG---RRQVTKMLFALVVVFGICWAPFHADRIMWSLVYGHSTEGLHL-----AYQCVHIAS 342

  Fly   330 GVLYFLSTCINPLLYNIMSHKFREAFKVTLARHFGLGGKNQGRGLPH--TYSALRRNQTGS 388
            |:.::|.:..||:||::||.:|||.|...|    |||.:...|..|:  :::.:|.. |||
Mouse   343 GIFFYLGSAANPVLYSLMSTRFRETFLQAL----GLGTQCCHRRQPYHGSHNHIRLT-TGS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 108/290 (37%)
Nmur1NP_001306156.1 7tm_4 64..>195 CDD:304433 59/133 (44%)
7tm_1 77..357 CDD:278431 108/290 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66693370
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T130989
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
87.830

Return to query results.
Submit another query.