DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and Cckbr

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_031653.1 Gene:Cckbr MGIID:99479 Length:453 Species:Mus musculus

Alignment Length:422 Identity:105/423 (25%)
Similarity:164/423 (39%) Gaps:123/423 (29%)


  Fly    27 LLNLTQVLNISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVI 91
            |||.:...|:|.:  |..::|....||        .|::..||   ||:||:..|.||::..:|:
Mouse    28 LLNSSSAGNLSCE--TPRIRGTGTREL--------ELTIRITL---YAVIFLMSVGGNVLIIVVL 79

  Fly    92 SRNNFMHTATNFYLFNLAISDMILLCSGMPQDLY-NLWHPDNYPFSDSICILESVLSETAANATV 155
            ..:..:.|.||.:|.:||:||::|..:.||..|. ||.  ..:.|...||...|.|...:.:.:.
Mouse    80 GLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLM--GTFIFGTVICKAVSYLMGVSVSVST 142

  Fly   156 LTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMG---TSC 217
            |.:.|..:|||.|||.|.:.......|.|.:.|.|.|:.:.||.:|..:.  .|:|.:|   ..|
Mouse   143 LNLAAIALERYSAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYPVY--TVVQPVGPRILQC 205

  Fly   218 TMKNDFFAHVF----------AVSGFLFFGGPMTAICVLYVLIG--------------------- 251
                   .|::          .:...|.|..|...:.|.|.||.                     
Mouse   206 -------MHLWPSERVQQMWSVLLLILLFFIPGVVMAVAYGLISRELYLGLRFDGDNDSETQSRV 263

  Fly   252 -------------------------------------VKLKRSRLLQAL-----------PRRCY 268
                                                 |:|.||||....           ||   
Mouse   264 RNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCYVQLPRSRLEMTTLTTPTTGPGPGPR--- 325

  Fly   269 DVNRG-ISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVY---GSTSGIESQWFNDVFSILDYTS 329
             .|:. :.|:.||:|||:.:.:.||:||.|.::......:   |:...:.....:.: .:|.|| 
Mouse   326 -PNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANTWRAFDGPGARRALAGAPISFI-HLLSYT- 387

  Fly   330 GVLYFLSTCINPLLYNIMSHKFREAFKVTLAR 361
                  |.|.|||:|..|..:||:|...|.||
Mouse   388 ------SACANPLVYCFMHRRFRQACLDTCAR 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 80/348 (23%)
CckbrNP_031653.1 7tm_4 60..>191 CDD:304433 45/136 (33%)
7tm_1 71..396 CDD:278431 80/348 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.