DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and LOC108648264

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_017951879.1 Gene:LOC108648264 ID: Length:351 Species:Xenopus tropicalis

Alignment Length:357 Identity:117/358 (33%)
Similarity:170/358 (47%) Gaps:31/358 (9%)


  Fly    35 NISADNLTSLLQGLEPEEL--LPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFM 97
            |:||.| |........|::  |..:..:.|:::|.      ..:|:.|:.|||:|.||..|...|
 Frog     4 NVSAAN-TGSHSNYTTEDMDSLFHIYVLVPVTILC------ISLFLLGITGNLLTIIVFKRYRDM 61

  Fly    98 HTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFT 162
            .:..|.||.::|:|| ||:..|:|.|||.:|....|.|.:.:|.....|||:....|:|.||..:
 Frog    62 RSTVNMYLSSMAVSD-ILIFLGLPSDLYRIWKYKPYAFGNFVCKFLVYLSESCTYCTILHITMVS 125

  Fly   163 VERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSV----------VMQGMGTSC 217
            :|||||||.|.:...:....|....|..:||.|||.|.|....|.|          ..:...|..
 Frog   126 IERYIAICFPLKAKIIITKRRVKIVIILLWIFALLTASPILFLFGVEHPPGFQPEETKECKYTEQ 190

  Fly   218 TMKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIR 282
            :.:|... ||......::|..||..:..||.||..||.::|.....|.   ..||| ......::
 Frog   191 SAQNGLL-HVMTWVSTIYFFLPMFFLTFLYGLICRKLWQTRHWARGPA---TANRG-KYNKATVK 250

  Fly   283 MLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIM 347
            ||..|.|.|.:||.|||..|::.   :.:|:....|.:|....:..|.||::||..|||:|||||
 Frog   251 MLAVVVVCFMLCWLPFHIGRILF---ALAGVGEYVFFEVTQYFNLLSMVLFYLSASINPMLYNIM 312

  Fly   348 SHKFREAFKVTLARHFGLGGKNQGRGLPHTYS 379
            |.|:|.|.:..|....||   ..||...:.:|
 Frog   313 SEKYRSAMRRMLYPKQGL---QSGRTRSYRFS 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 92/271 (34%)
LOC108648264XP_017951879.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.