DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and LOC101732366

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_004918724.1 Gene:LOC101732366 ID: Length:373 Species:Xenopus tropicalis

Alignment Length:354 Identity:92/355 (26%)
Similarity:161/355 (45%) Gaps:58/355 (16%)


  Fly    41 LTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVI--SRNNFMHTATNF 103
            :||....:.|....|.......:...:::|:.|.|:..||:|||.:...|:  .|...:..:.:.
 Frog     1 MTSTTSSMPPVSKPPEAEVRLSIYAKSSISLTYMLLLFAGILGNAMVIRVLWGLRRRRVQASLSH 65

  Fly   104 YLFNLAISDMILLCSGMPQDLY-NLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYI 167
            ::.:||..|::.|..|:|.:|| ::|.|..:|..:..|.....|.|....|.:..:.:.:.||::
 Frog    66 HMCSLASCDLLQLVLGIPAELYGSIWSPFPWPLGNIGCCGFYYLWEVLCYAAIFNVLSLSCERHL 130

  Fly   168 AICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTS-----------CT--- 218
            |.|.|...| :.:.|..::..| ||:.:||..||  :.|::.::.:..:           ||   
 Frog   131 ATCRPLSLH-LRQSSVRLRLCF-IWLMSLLAGLP--VLFTMGLEDVYAADVDDQHTELWVCTPLS 191

  Fly   219 -MKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSR------------------LLQALP 264
             .|..|.|.::|  .||.:.|.::       ::|:...|.|                  .:|.|.
 Frog   192 SRKGLFVATIWA--SFLTYLGVLS-------VVGITCWRMRRALQGSASQDVEVAGPGGSVQLLG 247

  Fly   265 RRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFS---ILD 326
            |.|  ..:.::|:.:..|||..:..|..:||.||.|:|||.|..|    :.||..:.:.   .|.
 Frog   248 RFC--SGQTVTARKQNARMLGCIVGALAVCWLPFQARRLMTVLRS----KDQWTENYYRSYITLQ 306

  Fly   327 YTSGVLYFLSTCINPLLYNIMSHKFREAF 355
            ..:...|:||:|:.|||||:.|..||.||
 Frog   307 PITNCFYYLSSCLTPLLYNLTSQSFRRAF 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 75/300 (25%)
LOC101732366XP_004918724.1 7tm_1 43..324 CDD:278431 75/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.