DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and ntsr2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_017949971.1 Gene:ntsr2 ID: Length:430 Species:Xenopus tropicalis

Alignment Length:430 Identity:115/431 (27%)
Similarity:202/431 (47%) Gaps:101/431 (23%)


  Fly    61 TPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHT---ATNFYLFNLAISDMILLCSGMPQ 122
            |..|....::|.|.|||:.|.:||::|..::.:.:..|.   ..:::|.::|:||:::|...:|.
 Frog    31 THFSSKVFITVFYILIFLVGTIGNVLTIRLVLKKHNRHKLQGTVHYHLVSMALSDILILLISIPI 95

  Fly   123 DLYN-LWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERYIAICHPF-RQHTMSKLSR 183
            :||| :|  .:||  |.|::|.....|.:..:.||||.||:.:.|||:|||||. .:..|||: |
 Frog    96 ELYNFIW--VHYPWIFGDAVCRSYYFLRDICSYATVLNITSLSCERYLAICHPMTAKRIMSKM-R 157

  Fly   184 AVKFIFAIWIAALLLALPQA----IQF------------SVVMQGMGTSCTMKNDFFAHVF-AVS 231
            ..|.:..||.::::.|:|.|    :::            |::...:.::.|:|      || .|:
 Frog   158 TKKILSVIWFSSVVFAMPMAFIMGVKYENTTPEGEEDPSSLICTNLVSTATLK------VFIQVN 216

  Fly   232 GFLFFGGPMTAI-CVLYVLIG-VKLKRSRLLQAL------PRRCYDVN---RGISAQTRV----- 280
            .|:.|..|:..| |:..|.:. ::..|||...:|      |:..|..:   :.:|:...|     
 Frog   217 VFVSFLLPLALISCLNCVTVNQLESLRSRYFLSLHSSSKAPQASYRAHVSLKPVSSSPAVKKLSV 281

  Fly   281 ------------------------IRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDV 321
                                    |.||.|:.:|:.:||.|:||:|||..|..    :..|...:
 Frog   282 AGATSKSSLTVSCEPNRIQPIQHSIYMLRAIVIAYVVCWLPYHARRLMFCYIP----DDYWTGFL 342

  Fly   322 FSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAFKVTLARHFGLGGKNQGRGLPHTYSALRR 383
            ::...|   .:..|:::|:.:||:|||::|..|||.|..||.                 :|..|:
 Frog   343 YTFYHYFYMLTNTLFYVSSAVNPILYNMVSSSFRELFLETLG-----------------FSRRRK 390

  Fly   384 NQ--TGSLRLHTTDSVRTTMTSMATTTTGLNGSANGSGNG 421
            .|  ..|:.|.|  |:|:...::.|.|.....|...:.||
 Frog   391 EQQLNSSVSLQT--SLRSDTCTLHTPTNHRQASREETANG 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 85/328 (26%)
ntsr2XP_017949971.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.