DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and mlnr

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_003200046.1 Gene:mlnr ZFINID:ZDB-GENE-130530-1015 Length:345 Species:Danio rerio

Alignment Length:378 Identity:124/379 (33%)
Similarity:176/379 (46%) Gaps:71/379 (19%)


  Fly    53 LLPTVT--PMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMIL 115
            |.||.|  |:|.:.:         .:||.||.||.:|.::|.|...|.|.||.||.::||||:::
Zfish    10 LFPTSTLIPVTTICI---------FLFIIGVTGNTMTILIIQRFKDMKTTTNLYLSSMAISDLVI 65

  Fly   116 LCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFR-QHTMS 179
            ..| :|.|||.||....:.|.:.:|.|...::|...|||:|.||..::|||:|||.||: :..::
Zfish    66 FLS-LPFDLYRLWKYVPWIFGEFVCRLSHYINEGCTNATILHITVLSMERYLAICFPFKAKAAIT 129

  Fly   180 KLSRAVKF-IFAIWIAALLLALPQAIQFSV-----VMQGMGT-SCTMKNDFFAHVFAVSGFL--- 234
            |  |.||: |.|:|..|||.|.|......|     .|...|: .|  |:..:|   ..||.|   
Zfish   130 K--RRVKYVILALWGFALLSAAPMFFLMGVEYENETMPDPGSRQC--KHTRYA---IESGLLHTT 187

  Fly   235 ------FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRC--YDVNRGISAQTRVIRMLVAVAVAF 291
                  :|..||..:..||..||.||.:||.....|...  ..|||      :.:::|..|...|
Zfish   188 IWVSTAYFFCPMFCLLFLYGSIGRKLWKSRHELHGPNAAARQKVNR------QTVKILAVVVSVF 246

  Fly   292 FICWAPFHAQRLMAVYGST--SGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREA 354
            .|||.|:|..|.:..:...  |...||.||       ..|.||::||..:||:|||:||:|:|.|
Zfish   247 AICWLPYHIGRFLFTHVDDYHSARLSQNFN-------VASMVLFYLSASVNPVLYNLMSNKYRSA 304

  Fly   355 FKVTLARHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVRTTMTSMATT 407
            .|....             ||..|....|.     .:.|.|.:..|:..:..|
Zfish   305 VKRLFL-------------LPRGYQGTNRR-----HISTRDDITETLNGVKET 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 98/282 (35%)
mlnrXP_003200046.1 7tm_4 24..>153 CDD:304433 56/141 (40%)
7tm_1 33..294 CDD:278431 98/282 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66708207
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.