DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and nmur2

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_002940961.1 Gene:nmur2 XenbaseID:XB-GENE-6046084 Length:397 Species:Xenopus tropicalis

Alignment Length:316 Identity:114/317 (36%)
Similarity:181/317 (57%) Gaps:28/317 (9%)


  Fly    63 LSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYNL 127
            |||..||.  ||.||:.||:||.:.|:||.:::.|.|.||:|||:||:||:::|..|||.::|.:
 Frog    43 LSLPMTLV--YATIFLIGVIGNTLVCLVILKHHNMRTPTNYYLFSLAVSDLLVLLLGMPLEVYEM 105

  Fly   128 WHPDNYPFSDSI--CILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFA 190
            |  .||||....  |..::||.||...|::|::|..:||||:||.|||:....|..|||:|.:..
 Frog   106 W--SNYPFLFGAWGCYFKTVLFETVCFASILSVTTVSVERYVAIIHPFQAKLKSTRSRALKILVT 168

  Fly   191 IWIAALLLALPQAIQFSVVMQGM--------GTSCTMKNDFFAH--VFAVSGFLFFGGPMTAICV 245
            :||.::|.::|......:::|..        ..:||:....:.:  :..|:..||:..||..|.|
 Frog   169 LWIFSILFSIPNTSTHGILLQYFPNGSLIPDSATCTVVQPLWIYNCIIQVTSLLFYILPMGVISV 233

  Fly   246 LYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGST 310
            ||.|:|:||:....|:| .:...:|.|  .::..:.:||..:.:.|.|||||||..||...:   
 Frog   234 LYCLMGIKLRGDHSLEA-DKMSVNVQR--PSRKSITKMLFVLVMVFGICWAPFHVDRLFFSF--- 292

  Fly   311 SGIESQW---FNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKVTLARHF 363
               ...|   ..:.|::....|||.::||:.:|||:||::|.:||.||:..|...|
 Frog   293 ---VLDWTEPLANAFNLTHVVSGVFFYLSSAVNPLIYNLLSRRFRSAFQNVLPPFF 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 94/276 (34%)
nmur2XP_002940961.1 7tm_4 53..>234 CDD:304433 66/183 (36%)
7tm_1 61..326 CDD:278431 94/276 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66697294
eggNOG 1 0.900 E33208_3BGH7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 1 1.000 FOG0001071
OrthoInspector 1 1.000 T129258
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
TreeFam 1 0.960
87.740

Return to query results.
Submit another query.