DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and ghsr

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_002931618.1 Gene:ghsr XenbaseID:XB-GENE-484475 Length:359 Species:Xenopus tropicalis

Alignment Length:348 Identity:120/349 (34%)
Similarity:175/349 (50%) Gaps:40/349 (11%)


  Fly    23 NEKFLLNLTQVLNISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLIT 87
            :|.::.|.|.....|::|.:      .||:  |..  :.|:.:|..::|...|:||.|:.||::|
 Frog     3 SEIYIQNRTMDYYYSSNNYS------WPED--PVF--LFPVPVLTGITVTCILLFIIGISGNVMT 57

  Fly    88 CIVISRNNFMHTATNFYLFNLAISD-MILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAA 151
            .:|:|:...|.|.||.||.::|.|| :|.||  ||.|||.||....:.|..|:|.|...:||...
 Frog    58 MLVVSKYKDMRTTTNLYLSSMAFSDLLIFLC--MPLDLYRLWQYRPWNFGSSLCKLFQFVSECCT 120

  Fly   152 NATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTS 216
            .:|:|.|||.:||||.|||.|.:...:....|....|..:|..:.:.|.|..:...|..:. ||:
 Frog   121 YSTILNITALSVERYFAICFPLKAKVVITKGRVKLVISVLWAVSFVSAGPIFVLVGVEHEN-GTN 184

  Fly   217 CTMKNDFFAHVFAV-SGFL---------FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVN 271
            ....|:..|..:|: ||.|         ||..|:..:.|||.|||.||.|.:.....|..  .:.
 Frog   185 PLDTNECKATEYAIKSGLLTIMVWTSSIFFFLPVFCLTVLYTLIGRKLWRRKRETIGPHT--SIR 247

  Fly   272 RGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSG-----IESQWFNDVFSILDYTSGV 331
            ...:.||  ::||..|..||.:||.|||..|.:......:|     :.||:.|.|       |.|
 Frog   248 DKHNKQT--VKMLAVVVFAFILCWLPFHVARYLFSKSFEAGSLEIALISQYCNLV-------SFV 303

  Fly   332 LYFLSTCINPLLYNIMSHKFREA 354
            |::||..|||:||||||.|:|.|
 Frog   304 LFYLSAAINPILYNIMSKKYRVA 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 97/277 (35%)
ghsrXP_002931618.1 7tm_4 48..334 CDD:304433 107/294 (36%)
7tm_1 53..316 CDD:278431 97/277 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66695670
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.