DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and mlnr

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_002935793.1 Gene:mlnr XenbaseID:XB-GENE-940650 Length:364 Species:Xenopus tropicalis

Alignment Length:353 Identity:114/354 (32%)
Similarity:176/354 (50%) Gaps:63/354 (18%)


  Fly    62 PLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYN 126
            |::.|..:::...::.:.||:||.||.::|.|...|.|.|||||.::|:||:|:|.| :|.|||.
 Frog    31 PITTLIPVTIVLLIVMVVGVIGNTITILIIRRYKEMRTTTNFYLSSMAMSDLIILLS-LPFDLYR 94

  Fly   127 LWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFIFAI 191
            ||....:.|...:|.....:||....:|:|.|||.::|||:|||.|.:...:...:|....|..:
 Frog    95 LWKSMPWIFGGFLCRFLHFISEGCTYSTILHITALSIERYLAICFPLKSKVLITKTRVKCVIVFL 159

  Fly   192 WIAALLLALPQAIQFSVVMQGMGTSCTMKND----------FFA-HVFAVSGFL---------FF 236
            |:.|||.|.|    |..|: |:.....:.||          |:| |    ||.|         :|
 Frog   160 WVFALLSAGP----FYFVV-GIAQMYNITNDSDTGWECRYTFYAVH----SGLLNVMMWVTTTYF 215

  Fly   237 GGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTR------VIRMLVAVAVAFFICW 295
            ..||..:.:||..||.||.:|:          :..||.:...|      .:|:|..|.:||.|||
 Frog   216 FIPMFCLIILYGFIGKKLWKSQ----------NSIRGRNTAQRDKSHRQTMRILAVVVLAFIICW 270

  Fly   296 APFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFRE-AFKVTL 359
            .|||..|:  |:.:|.|.|...|:..|:::...   |::||..|||:|||::|.|:|. |:|:. 
 Frog   271 LPFHIGRI--VFANTEGYEMMKFSQYFNVVAIQ---LFYLSASINPILYNLISKKYRSAAYKLL- 329

  Fly   360 ARHFGLGGKNQGRGLPHTYSALRRNQTG 387
                     ........||:.: :|.||
 Frog   330 ---------RPSTAKKKTYNTI-KNDTG 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 98/287 (34%)
mlnrXP_002935793.1 7tm_4 43..>225 CDD:304433 65/192 (34%)
7tm_1 52..314 CDD:278431 98/287 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66718494
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.