| Sequence 1: | NP_731788.1 | Gene: | PK2-R2 / 41638 | FlyBaseID: | FBgn0038139 | Length: | 599 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002666717.1 | Gene: | ghsrb / 100332193 | ZFINID: | ZDB-GENE-090327-1 | Length: | 365 | Species: | Danio rerio |
| Alignment Length: | 361 | Identity: | 123/361 - (34%) |
|---|---|---|---|
| Similarity: | 177/361 - (49%) | Gaps: | 43/361 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 35 NISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHT 99
Fly 100 ATNFYLFNLAISD-MILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTV 163
Fly 164 ERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTSCTMKNDFFAHVF 228
Fly 229 AV-SGFL---------FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRM 283
Fly 284 LVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMS 348
Fly 349 HKFREA----FKVTLARHFGLGGKNQGRGLPHTYSA 380 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PK2-R2 | NP_731788.1 | 7tm_1 | 83..344 | CDD:278431 | 94/271 (35%) |
| ghsrb | XP_002666717.1 | 7tm_4 | 55..339 | CDD:304433 | 106/293 (36%) |
| 7tm_1 | 59..321 | CDD:278431 | 94/271 (35%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D380940at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24243 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.020 | |||||