DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and ghsrb

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_002666717.1 Gene:ghsrb ZFINID:ZDB-GENE-090327-1 Length:365 Species:Danio rerio

Alignment Length:361 Identity:123/362 (34%)
Similarity:177/362 (49%) Gaps:43/362 (12%)


  Fly    35 NISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHT 99
            ||...|.||       |:..|  ..:.|:.:|..::|..:.:|:.|:.|||:|.:|:::...|.|
Zfish    20 NIMDSNATS-------EDEYP--VHLFPVPILTGITVTCSFLFLVGIAGNLLTILVVTKYKDMRT 75

  Fly   100 ATNFYLFNLAISD-MILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTV 163
            .||.||.::|:|| :|.||  ||.|||.:|....:.|.|.:|.|...:||:...:|:|.|||.:|
Zfish    76 TTNLYLCSMALSDLLIFLC--MPLDLYRVWRYRPWNFGDELCKLFQFVSESCTYSTILNITALSV 138

  Fly   164 ERYIAICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVMQGMGTSCTMKNDFFAHVF 228
            |||.|||.|.|...:....|....|..:|..||..|.|..|...|..:. ||:....|:..|..:
Zfish   139 ERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHEN-GTNAWETNECKATEY 202

  Fly   229 AV-SGFL---------FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRM 283
            |: ||.|         ||..|:..:.|||.|||.:|.|.:.....|....|     .:..:.::|
Zfish   203 AIRSGLLTMMVWVSSVFFFLPVLCLTVLYSLIGRRLWRRKENPVGPISSRD-----KSNKQTVKM 262

  Fly   284 LVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMS 348
            |..|.:||.:||.|||..|.:.  ..:|...|...:.:....:..|.||::||..|||:||||||
Zfish   263 LAVVVLAFVLCWLPFHVGRYLV--SKSSEANSPVISQISEYCNLVSFVLFYLSAAINPILYNIMS 325

  Fly   349 HKFREA----FKVTLARHFGLGGKNQGRGLPHTYSA 380
            .|||.|    |:|..|         .||.|....:|
Zfish   326 KKFRSAACKLFRVKRA---------PGRSLQSIVNA 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 95/272 (35%)
ghsrbXP_002666717.1 7tm_4 55..339 CDD:304433 107/294 (36%)
7tm_1 59..321 CDD:278431 95/272 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66700555
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.