DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PK2-R2 and LOC100331465

Sequence 1:NP_731788.1 Gene:PK2-R2 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_017213239.1 Gene:LOC100331465 ID: Length:442 Species:Danio rerio

Alignment Length:438 Identity:113/439 (26%)
Similarity:182/439 (41%) Gaps:113/439 (26%)


  Fly     1 MAVKMLPTNSSGVLATDLQLFHNEKFLLNLTQVLNISADNLTSLLQG-LEPEELLPTVTP----- 59
            |.:::|  |.:|:.|. ||| ||       ..:||.|::....:..| .|...|||.:.|     
Zfish     1 MDLQLL--NDTGIWAC-LQL-HN-------ASILNRSSNGSLEVPNGTCEDALLLPKIEPARAKE 54

  Fly    60 MTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDL 124
            |..|.:|.     |.|||:..|.|||:..:|:..|..|.|.||.:|.:|||||:::....||..|
Zfish    55 MDSLRILL-----YCLIFLLSVFGNLLIIVVLMVNKRMRTVTNSFLLSLAISDLMMAVVCMPFTL 114

  Fly   125 Y-NLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKFI 188
            . ||.  .::.|..::|.:.:.|...:...:..::.|..:|||.|||:|.:.......|.|.|.|
Zfish   115 IPNLM--GDFIFGAAMCKIVAYLMGISVCISTFSLVAIAIERYSAICNPLKSRAWQTRSHAYKVI 177

  Fly   189 FAIWIAALLLALPQAIQFSVVMQGMGTSCTMKNDFFAHV--------------FAVSGFLFFGGP 239
            .:.|:.:.|:..|..| ||.:::     .|..|:...|:              ..:..|:.|..|
Zfish   178 ASTWVVSFLIMTPYPI-FSTLVE-----FTKNNNITGHMCRHDWKNSEVEKAWCILLLFVLFFIP 236

  Fly   240 MTAICVLYVLIGVKLKRSRLLQALPRR----------------------CY-------------- 268
            ...:.:.|.||..:|.|....:...::                      ||              
Zfish   237 GVVMIIAYGLISRELYRGIQFELEQKKGQCGMKNGISATVLISSDDGDGCYIQVSKRPNSMEMSA 301

  Fly   269 -------DVNR--------GISAQTRVIRMLVAVAVAFFICWAPFH------AQRLMAVYGSTSG 312
                   .|:|        .:.|:.||||||:.:...|||||.|.:      |..|.:.:.:.||
Zfish   302 LTPTGSAKVDRPRSNTSEAKLMAKKRVIRMLIVIVAMFFICWMPVYSVNTWKAFDLASAHRALSG 366

  Fly   313 IESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKVTLA 360
            ....:.:    :|.||       |.|:||::|..|:.:||:|...|.:
Zfish   367 APISFIH----LLSYT-------SACVNPIIYCFMNKRFRKALLATFS 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 80/333 (24%)
LOC100331465XP_017213239.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.