DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8630 and AT1G06100

Sequence 1:NP_731781.1 Gene:CG8630 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_172100.1 Gene:AT1G06100 AraportID:AT1G06100 Length:299 Species:Arabidopsis thaliana

Alignment Length:348 Identity:92/349 (26%)
Similarity:146/349 (42%) Gaps:66/349 (19%)


  Fly    12 LAETAIADGNNNKMAATPAASAAPSAATPSQKVAKKAEAKTPENKPYELEIVWR--NVGLFVILH 74
            ::||...||::.|                  |..:|      |.:.|.|. .|.  :||....:.
plant     1 MSETTKDDGSSQK------------------KSVRK------EKRAYVLR-KWTQFDVGRASTVG 40

  Fly    75 SMALYGLYLVFAESAYWE------LLPVYATMFLGGLGITAGVHRLWSHKAYKAKLPLRIFLMLC 133
            ::.|..|...|  :..||      :|.:     |..|.||...||..:|:::|....|.......
plant    41 TVHLLCLLAPF--NYKWEAFRFGIILAI-----LTNLCITFSYHRNLTHRSFKLPKWLEYPFAYS 98

  Fly   134 QSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSK-GKQISMEDI 197
            ..||.|....:|...||.||:|||:..|||:...||:|:|:.|:....:  :..| |::.::.|:
plant    99 ALLALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTDY--IREKCGRRNNVMDL 161

  Fly   198 EQDPVVMFQKKMYFVVMPICCFALPMIF-----PY--YVMGSSLRVCFFTCSMLRFCLSLHFTWL 255
            :|.....|.||.  :|:.|..| ..:|:     ||  :.:|            ....:..|.|||
plant   162 KQQWFYRFLKKT--LVLHILAF-WTLIYLWGGLPYLTWTVG------------FGGVIGYHGTWL 211

  Fly   256 VNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVM 320
            ||||.|..|.:.:..|.::.|...::.||:||.|||.||.|....:.. |..|..:.|...|...
plant   212 VNSACHICGSQAWQTNDTSRNVWWLALLTMGESWHNNHHAFETSARHG-LEWYQLDITWYLIWFF 275

  Fly   321 AKIGQAYDLKFVSQEMVYKRVLR 343
            ..:|.|.::|..:.....|..:|
plant   276 QALGLATNVKLPTDAQKRKMAIR 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 73/254 (29%)
FA_desaturase 91..297 CDD:278890 67/220 (30%)
AT1G06100NP_172100.1 PLN02220 1..299 CDD:177866 92/349 (26%)
FA_desaturase 57..273 CDD:278890 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D971318at2759
OrthoInspector 1 1.000 T32177
orthoMCL 1 0.900 OOG5_126939
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.