DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8630 and CG9743

Sequence 1:NP_731781.1 Gene:CG8630 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_651781.1 Gene:CG9743 FlyBaseID:FBgn0039756 Length:420 Species:Drosophila melanogaster

Alignment Length:385 Identity:165/386 (43%)
Similarity:219/386 (57%) Gaps:21/386 (5%)


  Fly     8 STFILAETAIADGNNNKMAATPAASAAPSAATPSQKVAKKAEAKTPENKPYELEIVWRNVGLFVI 72
            :|...:.|.:.|.:|.......|............:..|:|| :..|.:.|..:|.|.::|....
  Fly    48 ATDATSHTLVKDDDNLGYKEENAVYKEQQLLQQQDQTLKEAE-QVEEEEEYHPQIRWPDLGAQAF 111

  Fly    73 LHSMALYGLYLVFAESAYWELLPVYATMFLGGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLA 137
            ||..||||||.:|..: ::..|.|..|:::.|:|||||.|||||||:|.|.|||||.|....|:|
  Fly   112 LHIGALYGLYQLFYAN-FYTFLWVVVTVWVSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIA 175

  Fly   138 FQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSKGKQISMEDIEQDPV 202
            .|...:.|..|||:||||::|.|||||::|||||||:|||....||.|.:|.|.|.|.|:|.|.|
  Fly   176 GQRDAYTWALDHRIHHKFSETDADPHNAKRGFFFAHVGWLFLTPHPKVVAKRKVIDMSDLEADAV 240

  Fly   203 VMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFTCSMLRFCLSLHFTWLVNSAAHFYGMKP 267
            .|||:|.|..:..:|...||:..|:|.....|.:.|:....:||..:|:..:.|||.||.||.||
  Fly   241 CMFQRKYYIPLFALCSIILPVAVPWYFWNEDLWMSFWINFNMRFTWTLNVAFFVNSVAHMYGNKP 305

  Fly   268 YDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQAYDLKFV 332
            ||.|:.:....:||.|.:||||||||||||||||..|.|.||.|.||.|||..|.:|.|...|.|
  Fly   306 YDKNLMSTEAPIVSLLAMGEGWHNYHHVFPWDYKTGEFGNYSLNITTGFIDFCAWLGLAKGRKSV 370

  Fly   333 SQEMVYKRVLRTGDGSHIAALLDANNNSAIPTSELVAHLDHEKEEHAIWGWDDKDISEED 392
            |.:||.:|..:.|||:.   .||.::          ||.|      .:||:.||||..||
  Fly   371 SPDMVLRRAKKCGDGTR---FLDDDH----------AHKD------PVWGFGDKDIPRED 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 121/240 (50%)
FA_desaturase 91..297 CDD:278890 103/206 (50%)
CG9743NP_651781.1 Delta9-FADS-like 130..368 CDD:239582 121/238 (51%)
FA_desaturase 131..335 CDD:278890 103/204 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1756
Isobase 1 0.950 0.837287 Normalized mean entropy S1208
OrthoDB 1 1.010 D296120at33208
OrthoFinder 1 1.000 FOG0000495
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.