DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8630 and Scd2

Sequence 1:NP_731781.1 Gene:CG8630 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_033154.2 Gene:Scd2 MGIID:98240 Length:358 Species:Mus musculus

Alignment Length:345 Identity:163/346 (47%)
Similarity:217/346 (63%) Gaps:26/346 (8%)


  Fly    26 AATPAASAAPSAATPSQKVAKKAEAKT--------PENK--------------PYELEIVWRNVG 68
            :||...:|.||..  .|...:|.|..:        ||.|              |.:||.||||:.
Mouse    14 SATTTITAPPSGG--QQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQDDEGPPPKLEYVWRNII 76

  Fly    69 LFVILHSMALYGLYLVFAESAYWELLPVYATMFLGGLGITAGVHRLWSHKAYKAKLPLRIFLMLC 133
            |..:||..||||:.||.:...| ..|..|....:..||||||.||||||:.|||:||||:||::.
Mouse    77 LMALLHLGALYGITLVPSCKLY-TCLFAYLYYVISALGITAGAHRLWSHRTYKARLPLRLFLIIA 140

  Fly   134 QSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSKGKQISMEDIE 198
            .::||||.::||.||||.||||::||||||||||||||:|:|||:.:|||.|..||.::.|.|::
Mouse   141 NTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSDLK 205

  Fly   199 QDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFTCSMLRFCLSLHFTWLVNSAAHFY 263
            .:.:||||::.|...:.:.||.||.:.|:|..|.:........:.||:.:.|:.|||||||||.|
Mouse   206 AEKLVMFQRRYYKPGLLLMCFVLPTLVPWYCWGETFVNSLCVSTFLRYAVVLNATWLVNSAAHLY 270

  Fly   264 GMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQAYD 328
            |.:|||.|:|:..|.|||...:|||:|||||.||:||.|:|. .:..|:||.|||.||.:|.|||
Mouse   271 GYRPYDKNISSRENILVSMGAVGEGFHNYHHAFPYDYSASEY-RWHINFTTFFIDCMALLGLAYD 334

  Fly   329 LKFVSQEMVYKRVLRTGDGS 348
            .|.||:..|..|:.||||||
Mouse   335 RKRVSRAAVLARIKRTGDGS 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 125/240 (52%)
FA_desaturase 91..297 CDD:278890 107/206 (52%)
Scd2NP_033154.2 Delta9-FADS-like 96..336 CDD:239582 125/242 (52%)
FA_desaturase 101..305 CDD:278890 108/204 (53%)
Histidine box-1. {ECO:0000305} 119..124 5/5 (100%)
Histidine box-2. {ECO:0000305} 156..160 3/4 (75%)
Histidine box-3. {ECO:0000305} 297..301 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1398
Hieranoid 1 1.000
Homologene 1 1.000 H136612
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126939
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.670

Return to query results.
Submit another query.