DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8630 and fat-5

Sequence 1:NP_731781.1 Gene:CG8630 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_507482.1 Gene:fat-5 WormBaseID:WBGene00001397 Length:333 Species:Caenorhabditis elegans

Alignment Length:306 Identity:143/307 (47%)
Similarity:195/307 (64%) Gaps:13/307 (4%)


  Fly    42 QKVAKKAEAKTPENKPYELEIVWRNVGLFVILHSMALYGLY-LVFAESAYWELLP-VYATMFLGG 104
            |:.:||...|        :||||:||.|||.||..||.||| |||  .|.|..:. |:....||.
 Worm    26 QEESKKQVIK--------MEIVWKNVALFVALHIGALVGLYQLVF--QAKWATVGWVFLLHTLGS 80

  Fly   105 LGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGF 169
            :|:|.|.||||:|:||||.|..|:||||..|:||||.|.:|.||||.|||:|||.||||::.||.
 Worm    81 MGVTGGAHRLWAHRAYKATLSWRVFLMLINSIAFQNDIIDWARDHRCHHKWTDTDADPHSTNRGM 145

  Fly   170 FFAHMGWLMCKKHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSL 234
            ||||||||:.|||..:..:|.::.:.|:.:|||:|||:|.|..::.|.|||||...|..:.|.|.
 Worm   146 FFAHMGWLLVKKHDQLKIQGGKLDLSDLYEDPVLMFQRKNYLPLVGIFCFALPTFIPVVLWGESA 210

  Fly   235 RVCFFTCSMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWD 299
            .:.|:|.::.|:|.:||.||.:||.:|:.|.:|||...|:::|...|...:|||.|||||.||.|
 Worm   211 FIAFYTAALFRYCFTLHATWCINSVSHWVGWQPYDHQASSVDNLWTSIAAVGEGGHNYHHTFPQD 275

  Fly   300 YKAAELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTG 345
            |:.:|...: .|||...||..|.||..||.|...:|::.::..:.|
 Worm   276 YRTSEHAEF-LNWTRVLIDFGASIGMVYDRKTTPEEVIQRQCKKFG 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 116/241 (48%)
FA_desaturase 91..297 CDD:278890 102/207 (49%)
fat-5NP_507482.1 Delta9-FADS-like 65..305 CDD:239582 116/241 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106192887
eggNOG 1 0.900 E1_COG1398
Hieranoid 1 1.000
Homologene 1 1.000 H136612
Inparanoid 1 1.050 342 1.000 Inparanoid score I1366
Isobase 1 0.950 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D296120at33208
OrthoFinder 1 1.000 FOG0000495
OrthoInspector 1 1.000 T98014
orthoMCL 1 0.900 OOG5_126939
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.610

Return to query results.
Submit another query.