DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ravus and CG34149

Sequence 1:NP_731779.1 Gene:Ravus FlyBaseID:FBgn0038128 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001036745.1 Gene:CG34149 FlyBaseID:FBgn0083985 Length:305 Species:Drosophila melanogaster

Alignment Length:335 Identity:86/336 (26%)
Similarity:123/336 (37%) Gaps:94/336 (28%)


  Fly     7 TQEKLDALRSEYRPRRPCALLKYPRPKTKPEYQAIYPWLLPDETDPHFVFCAVCECRLSCKRSDL 71
            |.:|...|..|:|..:|    ||.:...:...:...|||.....||:..||..|:|.:.|.|..|
  Fly    22 TAKKSLKLDKEHRTLKP----KYNQKFCEKWLKIFDPWLRRAAEDPNKPFCRACQCTMDCNRCHL 82

  Fly    72 GKHEGSIKHSENAQRKSLPAKANNSSFNGSSSGAMKWEDTEDEEGLLQYGTDPQDDETEDEEEGE 136
            .:||.:.||..|.                              |.||..|               
  Fly    83 VRHERTTKHKRNL------------------------------EALLTKG--------------- 102

  Fly   137 LDETEGDCEDDEKRTQELEAQNDLETEPVIKQQRRTSETDSQNSGMLDYLPLHVTINEGPQSLPT 201
                ||      ...||..          |:|||  |:...|.. ::...||.......|.|.|.
  Fly   103 ----EG------AAVQEFR----------IRQQR--SKYYHQRK-LVVMEPLAENHELEPPSTPE 144

  Fly   202 TVSAYPTSSATATVAPPCRITIKK--------VPVHST-PLSGMCQAQEINSKAT-------ITP 250
            .:.....:..:...|...::|:.|        |....| |.|......:.:|.|:       :..
  Fly   145 PMPVMAIADQSLCSAASEKVTVPKQEFLSETEVTTKMTEPPSSHANCSDSSSSASKQEGIKLLMQ 209

  Fly   251 IHTTPS---YAARPLQSYQLQPLSPITPPRDS--LELFFDSICATVKNLPPKLATEGKIRVMQLI 310
            ||...:   .:.|.|...| :.||...||::.  ::|||:|:.::||.|.|||..|.|:||.|||
  Fly   210 IHQDKNELMESFRELMGSQ-RTLSHTPPPKEKNHVDLFFESVSSSVKALSPKLVAEAKMRVSQLI 273

  Fly   311 GELELRALCE 320
            .|||||.|.|
  Fly   274 CELELRGLSE 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RavusNP_731779.1 BESS 278..312 CDD:281011 17/36 (47%)
CG34149NP_001036745.1 BESS 243..275 CDD:281011 17/32 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2F7TD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.