DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 2mit and dma-1

Sequence 1:NP_001262529.1 Gene:2mit FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans

Alignment Length:422 Identity:109/423 (26%)
Similarity:181/423 (43%) Gaps:57/423 (13%)


  Fly    73 DSFRGELRYQQKRHKRELELNAPANKL---------NLTH----RDLRTFNSTGGQWKGDFQV-- 122
            |:...|:..|.....|.|.:..|:|::         |:..    |.||..|..........::  
 Worm    48 DTIYAEILNQLPLTLRSLHIQPPSNRIGSNKLRWNDNINRFAQLRVLRLINCQIPAMSRSIRLPS 112

  Fly   123 ITAMDLSSNQLESLSLDNFN---QLRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSCNKFSQIS 184
            :..:||.||.:|..::.||.   :||.|||.:|.|.::|..:.....:|.  :|.||.|..|.:|
 Worm   113 LEVLDLHSNNIEHATMSNFGGMPKLRVLDLSSNHLNILPTGVFTYLRALR--SLSLSNNTISDLS 175

  Fly   185 TSFFAQRLPQLKNLNLAHNEL-LNISRESFYNLLELQTLVLSHNNISDIDYETFLALPNLQYLDL 248
            |:.. :.|..|:.|.|..|.: :....|.|.::.:|..|.|:|.|:|.|.......:|.|:.|.:
 Worm   176 TNLL-RGLNSLRVLRLDRNPIPIEHINELFTDVSQLDELYLNHCNLSSIYSLALDRIPQLRQLGI 239

  Fly   249 SHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTGLCQVPAALAQSVR 313
            ..|.|.....:.|:.:|.|..|.:::|              |::|:.|  ...|..      ::.
 Worm   240 GGNNLKMVPTKELRSLPQLSVLDLSHN--------------SIQEITA--CAFCNT------NIS 282

  Fly   314 TLKLSDNWL-----KAINCGDMDSYPLLQYLDLSHSRIAQVEDDALG-RLELLESLFLDRNLLMR 372
            .|.||.|.|     ...|.....:.| |::||||.:.:...:...|| ..|.|.|:.|..|.|..
 Worm   283 KLDLSHNLLGISKDSPFNEDAFRTMP-LRHLDLSFNHMNDFDSKWLGWAQEELTSIALSGNFLKN 346

  Fly   373 VPSSLP---PSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIFLPP---LSLPKLLTLNL 431
            ...|..   .||.||.|.:|.|..:|.|......:|.:|::|.|.|.:||.   ..||.:.|.::
 Worm   347 FEESWTYTLKSLIHLELAYNHIKFIPVQLPSRYYHLISLNISGNELTYLPDNINTLLPNVKTFDI 411

  Fly   432 ESSGVESVSQSIVHTLPQLRDLLLEDNPIKCS 463
            .::...:.|.:.:..|..:..:.::.||..||
 Worm   412 TANRFHTFSHTDLAFLNNVEQVYVDGNPWDCS 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 64/240 (27%)
leucine-rich repeat 124..143 CDD:275380 7/22 (32%)
leucine-rich repeat 144..167 CDD:275380 8/23 (35%)
leucine-rich repeat 172..194 CDD:275380 8/22 (36%)
LRR_8 193..253 CDD:290566 17/61 (28%)
leucine-rich repeat 195..218 CDD:275380 6/24 (25%)
leucine-rich repeat 219..242 CDD:275380 8/23 (35%)
LRR_8 241..301 CDD:290566 13/60 (22%)
leucine-rich repeat 243..311 CDD:275380 13/68 (19%)
leucine-rich repeat 312..335 CDD:275380 7/28 (25%)
LRR_8 334..415 CDD:290566 28/85 (33%)
leucine-rich repeat 336..359 CDD:275380 8/24 (33%)
leucine-rich repeat 360..380 CDD:275380 6/23 (26%)
LRR_8 379..460 CDD:290566 23/84 (27%)
LRR_4 379..>415 CDD:289563 13/36 (36%)
leucine-rich repeat 381..404 CDD:275380 8/23 (35%)
leucine-rich repeat 405..449 CDD:275380 12/47 (26%)
dma-1NP_492253.1 LRR_8 90..147 CDD:290566 17/57 (30%)
leucine-rich repeat 91..112 CDD:275380 4/21 (19%)
LRR_RI 111..321 CDD:238064 63/236 (27%)
leucine-rich repeat 113..136 CDD:275380 7/23 (30%)
LRR_8 135..195 CDD:290566 21/63 (33%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
leucine-rich repeat 161..184 CDD:275380 9/26 (35%)
LRR_8 184..244 CDD:290566 17/60 (28%)
leucine-rich repeat 185..209 CDD:275380 6/24 (25%)
leucine-rich repeat 210..233 CDD:275380 8/23 (35%)
LRR_8 232..291 CDD:290566 18/81 (22%)
leucine-rich repeat 234..257 CDD:275380 6/23 (26%)
leucine-rich repeat 258..280 CDD:275380 7/44 (16%)
leucine-rich repeat 281..307 CDD:275380 6/26 (23%)
leucine-rich repeat 309..357 CDD:275380 14/48 (29%)
LRR_8 333..392 CDD:290566 19/59 (32%)
leucine-rich repeat 382..405 CDD:275380 9/23 (39%)
leucine-rich repeat 406..429 CDD:275380 3/23 (13%)
TPKR_C2 438..>478 CDD:301599 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000549
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.