DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 2mit and PODN

Sequence 1:NP_001262529.1 Gene:2mit FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_714914.2 Gene:PODN HGNCID:23174 Length:661 Species:Homo sapiens

Alignment Length:508 Identity:138/509 (27%)
Similarity:217/509 (43%) Gaps:104/509 (20%)


  Fly    33 DIPT-SSRLAAEREE-QQLSRQDVGRLSYQSIHRM--LRDENEPDSFRGELRYQQKRHKRELE-L 92
            |:|. ::.|:.:..: :::..:::.||     ||:  |..:|...:.|| |..:...|...|. |
Human   141 DLPEHTNHLSLQNNQLEKIYPEELSRL-----HRLETLNLQNNRLTSRG-LPEKAFEHLTNLNYL 199

  Fly    93 NAPANKLNLTHRDLRTFNSTGGQWKGDFQVITAMDLSSNQLESLSLDNFNQ---LRQLDLGNNSL 154
            ....|||.|..|.|.             ..:.::|.::|.|..:....|.|   ||.:.|.||  
Human   200 YLANNKLTLAPRFLP-------------NALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNN-- 249

  Fly   155 EVIPLSLADTNMSLPFVTLDLSCNKFSQISTSFFAQRLPQ-----LKNLNLAHNELLNISRESFY 214
                 .|||.  .||....:.|.|....|.:|.|.:.:|:     |..|:|.:|:|..|...:|.
Human   250 -----KLADA--GLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEKIPPGAFS 307

  Fly   215 NLLELQTLVLSHNNISD--IDYETFLALPNLQYLDLSHNRLSGSAIRALQGIP-DLVSLSIAYNP 276
            .|..|:.|.|.:|.::|  :|.|||..|.:|:|||||.|.||    |...|:| .||.|.:..|.
Human   308 ELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLS----RVPAGLPRSLVLLHLEKNA 368

  Fly   277 --------------------------DVGVAMQEFVASWSLKELDASGTGLCQVPAALAQSVRTL 315
                                      :.|:....|.....|..:......|.:||:.|.:.||||
Human   369 IRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALERVPSGLPRRVRTL 433

  Fly   316 KLSDNWLKAINCGDMDSYPLLQYLDLSHSRIA--QVEDDALGRLELLESLFLDRNLLMRVPSSLP 378
            .:..|.:..|...|..:...|:.|:||::||.  ||..||..:|.||.||.|..|.|..:|..||
Human   434 MILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLLRSLDLSGNRLHTLPPGLP 498

  Fly   379 ------------------------PSLEHLFLQHNQIME--LPPQAFVGLVNLQTLDLSNNRLIF 417
                                    ..|..|:|..|::..  |.|:|:|.|.:||.||::.|:|..
Human   499 RNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSRALGPRAWVDLAHLQLLDIAGNQLTE 563

  Fly   418 LPPLSLPKLLT-LNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIA 469
            :|. .||:.|. |.|:::.:.:|..:...:.|.|:.:.|..|.:....::..|
Human   564 IPE-GLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSA 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 79/270 (29%)
leucine-rich repeat 124..143 CDD:275380 4/19 (21%)
leucine-rich repeat 144..167 CDD:275380 8/23 (35%)
leucine-rich repeat 172..194 CDD:275380 6/22 (27%)
LRR_8 193..253 CDD:290566 26/67 (39%)
leucine-rich repeat 195..218 CDD:275380 8/23 (35%)
leucine-rich repeat 219..242 CDD:275380 10/25 (40%)
LRR_8 241..301 CDD:290566 19/87 (22%)
leucine-rich repeat 243..311 CDD:275380 23/95 (24%)
leucine-rich repeat 312..335 CDD:275380 7/23 (30%)
LRR_8 334..415 CDD:290566 35/109 (32%)
leucine-rich repeat 336..359 CDD:275380 11/25 (44%)
leucine-rich repeat 360..380 CDD:275380 9/44 (20%)
LRR_8 379..460 CDD:290566 26/84 (31%)
LRR_4 379..>415 CDD:289563 14/38 (37%)
leucine-rich repeat 381..404 CDD:275380 9/25 (36%)
leucine-rich repeat 405..449 CDD:275380 14/45 (31%)
PODNNP_714914.2 LRR_RI <123..346 CDD:238064 66/233 (28%)
leucine-rich repeat 127..144 CDD:275380 2/3 (67%)
leucine-rich repeat 148..169 CDD:275380 4/26 (15%)
LRR_8 149..206 CDD:290566 15/63 (24%)
leucine-rich repeat 170..195 CDD:275380 6/26 (23%)
leucine-rich repeat 196..240 CDD:275380 13/57 (23%)
leucine-rich repeat 241..266 CDD:275380 11/34 (32%)
leucine-rich repeat 267..287 CDD:275380 4/20 (20%)
LRR_RI 282..465 CDD:238064 54/187 (29%)
LRR_8 286..348 CDD:290566 25/62 (40%)
leucine-rich repeat 288..311 CDD:275380 8/23 (35%)
leucine-rich repeat 312..337 CDD:275380 10/25 (40%)
leucine-rich repeat 338..358 CDD:275380 12/24 (50%)
LRR_8 357..419 CDD:290566 7/62 (11%)
leucine-rich repeat 359..382 CDD:275380 4/23 (17%)
leucine-rich repeat 383..408 CDD:275380 2/25 (8%)
leucine-rich repeat 433..453 CDD:275380 4/20 (20%)
leucine-rich repeat 454..524 CDD:275380 21/70 (30%)
LRR_8 499..561 CDD:290566 14/62 (23%)
leucine-rich repeat 525..550 CDD:275380 9/25 (36%)
leucine-rich repeat 551..571 CDD:275380 9/21 (43%)
LRR_8 571..631 CDD:290566 9/46 (20%)
leucine-rich repeat 572..595 CDD:275380 5/23 (22%)
leucine-rich repeat 596..619 CDD:275380 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.