DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and lrrc4c

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_002938986.1 Gene:lrrc4c / 100188921 XenbaseID:XB-GENE-5772259 Length:639 Species:Xenopus tropicalis


Alignment Length:742 Identity:173/742 - (23%)
Similarity:270/742 - (36%) Gaps:201/742 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SC-NKFSQ-ISTSFFAQRLP-----QLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDID 233
            || |:||: |.|....:.:|     ..:.|||..|::..|..:||.:|..|:.|.||.|:|..|:
 Frog    52 SCSNQFSKVICTRRNLREVPDGISTNTRQLNLHENQIQIIKVDSFKHLRHLEVLQLSRNHIRTIE 116

  Fly   234 YETFLALPNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASG 298
            ...|..|.||..|:|..|||:.....|.:.:..|..|.:..||...:....|....||:.||   
 Frog   117 IGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLD--- 178

  Fly   299 TGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLELLESL 363
                     |.:..|        |..|:.|..:....|:||:|....:..:.:  |..|..|:.|
 Frog   179 ---------LGEMKR--------LSYISEGAFEGLSNLKYLNLGMCNLRDIPN--LTPLVKLDEL 224

  Fly   364 FLDRNLLMRVPSSLPPS-------LEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIFLPPL 421
            .|..|.|    |.|.|.       |:.|::.|:||..:...||..|.:|..|:|::|.|..||  
 Frog   225 DLSGNHL----SVLRPGSFQGLTHLQKLWIMHSQIQVIERNAFDDLQSLVELNLAHNNLTLLP-- 283

  Fly   422 SLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCS-DLLGIAEWASPCRSVDAGQSNG 485
                               ..:...|..|:.:.|..||..|: |:|.::.|..  ..|..|.:..
 Frog   284 -------------------HDLFTPLHNLQRIQLHHNPWNCNCDILWLSWWLK--EIVTTGSTCC 327

  Fly   486 ASVSGRVDLKTEYLQ--FHNFYENFSSRECGIRKPEND---TKPPSCSL-TRASATLT----TTP 540
            |..|....||..::.  .||::..::.   .|.:|..|   |:..:..| .|||.:||    .||
 Frog   328 ARCSTPPSLKGTHIAELDHNYFTCYAP---VIVEPPADLNVTEGMAAELKCRASTSLTYVSWITP 389

  Fly   541 RSMSKVEKSQEAQATATSVEVAAATAATSEKTG----IQATSAAQSTAAATTAEREAIATATSSD 601
            ........|.:.:.:..:......|..|...||    |.:.||..:||:||       ...|:||
 Frog   390 NGTIMTHGSYKVRISVLNDGTLNFTNVTVRDTGLYTCIVSNSAGNTTASAT-------LNVTASD 447

  Fly   602 TTATPTLAAAAAIQSAGNIPAQLTTKTLRPTETTSLAQLQRRQQMPGMPAKTTETPAKNLPSL-- 664
            |..|              ..:.:|.:|:.|::.               .|:||||.....|.:  
 Frog   448 TGYT--------------YFSTVTVETMEPSQD---------------EARTTETHVGPTPVIDW 483

  Fly   665 AQTKATTALPILATRDAATATTEINSDKPTNISGATKTVATSAAEIATPPAIEVPQTILAGKKSD 729
            ..|.|||:|...:||......|...:|....:.|..:.:.|:...|....||    |::|     
 Frog   484 ETTNATTSLMPQSTRFTEKTVTVPVTDANNGMPGIDEVMKTTKIIIGCFVAI----TLMA----- 539

  Fly   730 KMPADKAHETLLKYPTRDTSGQVATTPHKHATLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLP 794
                  |...::.|..|.               |.|.|:.|   .|                   
 Frog   540 ------AVMLVIFYKMRK---------------QHHRKNHH---AP------------------- 561

  Fly   795 GTATVADADSEVLDPSQQHQSAEQEKHQSATDKRQADAINGDTKSPAKGHKKKPSLSIKKMTYST 859
             |.||     |:::..                    |.:..||  |.:.|...|::..:.:.:..
 Frog   562 -TRTV-----EIINVD--------------------DELTADT--PIESHLPMPAIEHEHLNHYN 598

  Fly   860 KHAAKTVEDMAATSKTPQHQHSSVNTP 886
            .:  |:..:...|..|....||||:.|
 Frog   599 SY--KSPFNHTTTVNTINSIHSSVHEP 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 51/185 (28%)
leucine-rich repeat 124..143 CDD:275380
leucine-rich repeat 144..167 CDD:275380
leucine-rich repeat 172..194 CDD:275380 8/24 (33%)
LRR_8 193..253 CDD:290566 23/64 (36%)
leucine-rich repeat 195..218 CDD:275380 8/22 (36%)
leucine-rich repeat 219..242 CDD:275380 9/22 (41%)
LRR_8 241..301 CDD:290566 17/59 (29%)
leucine-rich repeat 243..311 CDD:275380 17/67 (25%)
leucine-rich repeat 312..335 CDD:275380 4/22 (18%)
LRR_8 334..415 CDD:290566 26/87 (30%)
leucine-rich repeat 336..359 CDD:275380 6/22 (27%)
leucine-rich repeat 360..380 CDD:275380 7/19 (37%)
LRR_8 379..460 CDD:290566 20/87 (23%)
LRR_4 379..>415 CDD:289563 13/42 (31%)
leucine-rich repeat 381..404 CDD:275380 8/22 (36%)
leucine-rich repeat 405..449 CDD:275380 8/43 (19%)
lrrc4cXP_002938986.1 LRRNT 47..78 CDD:214470 8/25 (32%)
LRR <77..302 CDD:227223 71/271 (26%)
leucine-rich repeat 78..101 CDD:275380 8/22 (36%)
leucine-rich repeat 102..125 CDD:275380 9/22 (41%)
leucine-rich repeat 126..149 CDD:275380 7/22 (32%)
leucine-rich repeat 150..173 CDD:275380 5/22 (23%)
leucine-rich repeat 174..198 CDD:275380 8/43 (19%)
leucine-rich repeat 199..220 CDD:275380 6/22 (27%)
leucine-rich repeat 221..244 CDD:275380 8/26 (31%)
leucine-rich repeat 245..268 CDD:275380 8/22 (36%)
leucine-rich repeat 269..290 CDD:275380 7/41 (17%)
LRRCT 301..351 CDD:214507 14/51 (27%)
Ig 354..443 CDD:416386 24/98 (24%)
Ig strand A 354..357 CDD:409353 0/5 (0%)
Ig strand A' 361..364 CDD:409353 1/2 (50%)
Ig strand B 370..377 CDD:409353 1/6 (17%)
Ig strand C 383..388 CDD:409353 0/4 (0%)
Ig strand C' 391..393 CDD:409353 0/1 (0%)
Ig strand D 402..406 CDD:409353 0/3 (0%)
Ig strand E 409..413 CDD:409353 0/3 (0%)
Ig strand F 423..430 CDD:409353 1/6 (17%)
Ig strand G 433..443 CDD:409353 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.